Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02380-AT5G15850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CONSTANS-like 2
Function (paralog2):CONSTANS-like 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.1407382000382
Log2 mRNA fold difference:-0.92032961698842
Log2 TE fold difference:-0.19798735396789
Sequences
Protein sequence

MLKEESNESGTWARACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQ
SCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPILPLSANSCSSMAPSETDAD
NDEDDREVASWLLPNPGKNIGNQNNGFLFGVEYLDLVDYSSSMDNQFEDNQYTHYQRSFG
GDGVVPLQVEESTSHLQQSQQNFQLGINYGFSSGAHYNNNSLKDLNHSASVSSMDISVVP
ESTASDITVQHPRTTKETIDQLSGPPTQVVQQLTPMEREARVLRYREKKKTRKFDKTIRY
ASRKAYAEIRPRIKGRFAKRIETEAEAEEIFSTSLMSETGYGIVPSF

MLKVESNWAQACDTCRSAACTVYCRADSAYLCSSCDAQVHAANRLASRHERVRVCQSCER
APAAFFCKADAASLCTTCDSEIHSANPLARRHQRVPILPISEYSYSSTATNHSCETTVTD
PENRLVLGQEEEDEDEAEAASWLLPNSGKNSGNNNGFSIGDEFLNLVDYSSSDKQFTDQS
NQYQLDCNVPQRSYGEDGVVPLQIEVSKGMYQEQQNFQLSINCGSWGALRSSNGSLSHMV
NVSSMDLGVVPESTTSDATVSNPRSPKAVTDQPPYPPAQMLSPRDREARVLRYREKKKMR
KFEKTIRYASRKAYAEKRPRIKGRFAKKKDVDEEANQAFSTMITFDTGYGIVPSF

www.000webhost.com

Other information
Ka divergence:0.119795KaKs divergence:-0.116226
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1044Length 2 (bp):1068Length divergence:0.011
MFE 1 (kcal):-321.69MFE 2 (kcal):-308.37MFE divergence-0.021