Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02410-AT5G15860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):prenylcysteine methylesterase

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.7264401955807
Log2 mRNA fold difference:3.1776599912785
Log2 TE fold difference:-0.53239433962623
Sequences
Protein sequence

MQLSPERCRPMSENREAWSANSEEMELLHGSNRLSSPEHVRRRVSGNSSEDGSPRICRQQ
SFGRDIGHAAAETYLITRLSFNLLGYLGVGYRWITRLLALACYAMLLMPGFLQVAYLYFF
SSQVRRSIVYGGHPRNRLDLYIPPTSDGLKPVVVFVTGGAWIIGYKAWGSLLGLQLAERD
IIVACLDYRNFPQGTISDMVSDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHISSCAL
FEQAIKESRGESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFK
QFSPEVRLKDLNVRKAAALLPHIILFHGSADYSIPPEASKTFTDALQAAEVKAELVMYKG
KTHTDLFLQDPLRGGKDELFDHIVSMIHADDSDALRNDAVAPPRKRLVPEFLLKLAGRVS
PF

MHSPLQTQQPEQRCWPMTSTVSEIEEVLPDEDSDRTTLLNGEPLRRRVSGKSPVDEGPRR
IFRQQSFGRDIGHAAAETYLITGLSFKLLRYLGVGYRWMTKLLALTCYAMLLMPGFLQVA
YSYFFSKQVRRSIVYGDQPRNRLDLYLPSNNDGLKPVVVFVTGGAWIIGYKAWGSLLGMQ
LAERDIIVACLDYRNFPQGTISDMVTDASQGISFVCNNISAFGGDPNRIYLMGQSAGAHI
AACALLEQATKELKGESISWTVSQIKAYFGLSGGYNLYKLVDHFHNRGLYRSIFLSIMEG
EESFEKFSPEVRLKDPVVGKAASLLPPIILFHGSSDYSIPCDESKTFTDALQAVGAKAEL
VLYSGKTHTDLFLQDPLRGGKDELFDDIVSVIHAEDNDGLTKDSLAPPRKRLVPELLLKL
AREISPF

www.000webhost.com

Other information
Ka divergence:-0.103454KaKs divergence:0.074401
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1269Length 2 (bp):1284Length divergence:0.006
MFE 1 (kcal):-405.42MFE 2 (kcal):-415.8MFE divergence0.013