Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02460-AT5G15930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ypt/Rab-GAP domain of gyp1p superfamily protein
Function (paralog2):plant adhesion molecule 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0833841302727
Log2 mRNA fold difference:0.36749260155529
Log2 TE fold difference:0.74250821039305
Sequences
Protein sequence

MSRKRTENGSESGPATSHVPVDRFGFLKQEHANSPERFSKSKTTSSTDHDREERKVRKWR
KMIGVGGSDWKHYVRRKPNVVRRRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVI
YETSASELDIIRDISRTFPSHVFFQKRHGPGQRSLYNVLKAYSVYDRDVGYVQGMGFIAG
LLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHAGLPLVQQYLFQLESLVKELIPKLGEHF
TQEMINPSMYASQWFITVFSYSFPFPLALRIWDVFLSEGVKIVFKVGLALLKYCQDELVK
LPFEKLIHALKTFPEDAMNPDTLLPLAYSIKVSKRLEELTLEYQKTNAKPVQP

MERKRTKDSEPGPVPLLVPVDRFGFLKQEHGSSPQRFTKTKSSINYEKEEKRVTKWRKMI
GTGGSDWKHYVRRKPHVVKRRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYVQLVIYET
SASELDIIRDISRTFPSHVFFQKRHGPGQRSLYNVLKAYSVYDRDVGYVQGMGFIAGLLL
LYMSEEDAFWLLVALLKGAVHSPIEGLYQAGLPLVQQYLLQFDQLVRELMPKLGEHFTQE
MINPSMYASQWFITVFSYSLPFHSALRIWDVFLAEGVKIVFKVGLALLKHCHDDLLKLPF
EELMHALRNFPEDAMDPDTLLPLAYSIKVSKRLEEMKQDCDKAVAKPTQTAKSVRQ

www.000webhost.com

Other information
Ka divergence:0.110037KaKs divergence:0.194116
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1062Length 2 (bp):1071Length divergence:0.004
MFE 1 (kcal):-321.8MFE 2 (kcal):-317.9MFE divergence-0.006