Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02490-AT5G15980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pentatricopeptide repeat (PPR) superfamily protein
Function (paralog2):Pentatricopeptide repeat (PPR) superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.3560107986836
Log2 mRNA fold difference:1.1568683826654
Log2 TE fold difference:0.18520396675224
Sequences
Protein sequence

MRYQWRSLLFRSYRSSPRPFLSHHSRFQVISNSTRSFSSFLHERFGVQQRQCLFALRSPL
ASSVSRRFSSESAIEEKLPAETVVIDVFSRLNGKDEITKELDSNDVVISHELALRVLREL
ESSPDVAGRFFKWGLEAYPQKLSSKSYNTMLRIFGVNGLVDEFWRLVDDMKKKGHGVSAN
VRDRVGDKFKKDGLENDLERLKELFASGSMDNSVDKVCNRVCKIVMKEVWGADVEKQLRD
LKLEFKSDVVKMVLEKLDVDPRKALLFFRWIDESGSFKHDEKTYNAMARVLGKEKFLDRF
QHMIEEIRSAGYEMEMETYVRVSARFCQTKMIKEAVELFEFAMAGSISNTPTPHCCSLLL
KKIVTAKKLDMDLFTRTLKAYTGNGNVVPDVMLQHVLKSLRSVDRFGQSNEVLKAMNEGG
YVPSGDLQSVIASGLSRKGKKDEANELVNFMEASGNHLDDKAMASLVEGHCDAKDLEEAS
ECFKKMIGKEGVSYAGYAFEKLVLAYCNSFQARDVYKLFSELVKQNQLKPWHSTYKIMVR
NLLMKKVARDGGFEEALSLLPMMRNHGFPPFVDPFMDYLSNSGTSAEAFAFLKAVTSKKF
PSNSMVLRVFEAMLKSARHSEAQDLLSMSPSYIRRNAEVLELFNTMKPEKCSLEKPLPAP
AQIEA

MRYQQWRLMLLRSYHRSHLPYLSPCSQVTSISSRSFSSFIHPGIGALQQSEQLCPLRSPM
TSSGNLVKSVGRSFSSEPAVEEKSSAEATVIDIFSRLSGEDEIRKELESSGVVISQDLAL
KVLRKLESNPDVAKSFFQWIKEASPEELSSKNYNMMLRILGGNGLVDEFWGLVDVMKKKG
HGLSANVRDKVGDKFQKDGLESDLLRLRKLFTSDCLDNSAENVCDRVCKIVMKEEWGDDV
EKRVRDLNVEFKSDLVKMIVERLDVEPRKALLFFRWIDESDLFKHDEKTYNAMARVLGKE
KFLDRFQNIVVEMRSAGYEVEIETYVRVSTRFCQTKLIKEAVDLFEIAMAGSSSSNNPTP
HCFCLLLKKIVTAKILDMDLFSRAVKVYTKNGNALTDSLLKSVLKSLRSVDRVEQSNELL
KEMKRGGYVPSGDMQSMIASSLSRKGKKDEADEFVDFMESSGNNLDDKAMASLVEGYCDS
GNLDEALVCFEKMVGNTGVSYADYSFEKLVLAYCNKNQVRDAYKLLSAQVTKNQLKPRHS
TYKSLVTNLLTKKIARDGGFEEALSLLPIMKDHGFPPFIDPFMSYFSSTGKSTEALGFLK
AMTSNNFPYISVVLRVFETMMKSARHSEAQDLLSLCPNYIRNNPDVLELFNTMKPNESAV
EKPLAASA

www.000webhost.com

Other information
Ka divergence:0.0838308KaKs divergence:-0.0844667
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1998Length 2 (bp):2007Length divergence:0.002
MFE 1 (kcal):-573.95MFE 2 (kcal):-575.13MFE divergence0.001