Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02500-AT5G16030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.8973036240896
Log2 mRNA fold difference:5.11510049618
Log2 TE fold difference:-1.0870352269754
Sequences
Protein sequence

MVLRGEELEFNLREWARQGHLTREDQSSRRFSASCIRSFREDHKSCTTNVTISSTASSPG
YSLKDEIDPSNYSFSSALKALQAKSVYKKNWDWLKPEGVELNSKWNEAEKYICNPLSGEV
PLECLSSKTLNSRSFRNLSTKHAPLMILPSNYNLNIPRTVNPKVRIIHEDPRSPDPVLIQ
DKKVVGSKRDVVSAQGNVSAAKTTPIMERLTKRQVGADDSPVEYALKLKAQQEDVKLEEN
EQNMMTKEIQEEKKEKKKRRGSGFSSWIRKMQRQPRKSKCIFLICLPHLIKAS

MALRGDEHEFMNLREWDRRARLIRENPSSRRFSASYIGSFREDHHKSSFRTTNFNNISST
ASSPGYTLKEEIDPSTYSFTNALKALQAKTMYNNREWLAQEGFALNSKWNEAEKYICNPL
SGEVPMECLSAKTLSARSFRNLSTMSAPLHFPSPNPLMNNIAQNKPNNNPNVRVIHEDLY
APDPELLALVNYGGVFLAEKKVVGMKRDVGIQSTTSVDLSSGSPSPAKTPPIMERSLKRH
VEADDWPVDINLKVKGQQQDVKLEEKEKEEEKQDMSNEEDEEEEEEEKQDMSEEDDKEEE
DEQEEEEKTKKKKRGPGCFSWVRSRQRQARKSKYIFPICVPHLVKGC

www.000webhost.com

Other information
Ka divergence:-0.406494KaKs divergence:-0.282436
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):882Length 2 (bp):1044Length divergence:0.084
MFE 1 (kcal):-226.3MFE 2 (kcal):-264.16MFE divergence0.077