Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02510-AT5G16040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Regulator of chromosome condensation (RCC1) family protein
Function (paralog2):Regulator of chromosome condensation (RCC1) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.16919731083262
Log2 mRNA fold difference:-0.67537152810165
Log2 TE fold difference:0.94716955450114
Sequences
Protein sequence

MVTATSIIAWGSGEDGQLGIGTNEEKEWACVVEALEPYSVRSVVSGSRNSLAICDDGTMF
TWGWNQRGTLGHQPETKTENIPSRVKALANVKITQAAIGGWHCLAVDDQGRAYAWGGNEY
GQCGEEPLKDEMGRPVRRDIVIPKRCAPKLTVRQVAAGGTHSVVLTREGHVWTWGQPWPP
GDIKQISVPVRVQGLENVRLIAVGAFHNLALEEDGRLLAWGNNEYGQLGTGDTQPTSHPV
PVQGLDDLTLVDIAAGGWHSTALTDKGEVYGWGRGEHGRLGLGDNDKSSKMVPQKVNLLA
EEDIIQVSCGGTHSVALTRDGRIFSFGRGDHGRLGYGRKVTTGQPLELPIKIPPPEGSFN
HTDEEEEGKWSAKSIACGGRHTLAIVEWKSDDI

MASATSVIAWGSGEDGQLGLGTDEEKELASVVDALEPFNVRSVVGGSRNSLAICDDGKLF
TWGWNQRGTLGHPPETKTESTPSLVKSLANVKIVQAAIGGWHCLAVDDQGRAYAWGGNEY
GQCGEEPSKDETGRPVRRDIVIPKRCAQQLTVRQVAAGGTHSVVLTREGYVWTWGQPWPP
GDIKQISVPVRVQGLENVRLIAVGAFHNLALKEDGTLWAWGNNEYGQLGTGDTQPRSYPI
PVQGLDDLTLVDIAAGGWHSTALTNEGEVYGWGRGEHGRLGFGDNDKSSKMLPQKVNLLA
GEDIIQVSCGGTHSVALTRDGRIFSFGRGDHGRLGYGRKVTTGQPLELPIHIPPPEGRFN
HTDEEDDGKWIAKHVACGGRHTLAIVEWKYDQEETE

www.000webhost.com

Other information
Ka divergence:-0.0491172KaKs divergence:-0.232802
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1182Length 2 (bp):1191Length divergence:0.004
MFE 1 (kcal):-363.7MFE 2 (kcal):-388.02MFE divergence0.032