Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02530-AT5G16070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TCP-1/cpn60 chaperonin family protein
Function (paralog2):TCP-1/cpn60 chaperonin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.062245209737421
Log2 mRNA fold difference:0.034237625716284
Log2 TE fold difference:-0.04618230317525
Sequences
Protein sequence

MSVRVLNPNAEVLNKSAALHMTINAAKGLQDVLKSNLGPKGTIKMLVGGSGDIKLTKDGN
TLLKEMQIQNPTAIMIARTAVAQDDISGDGTTSTVIFIGELMKQSERCIDEGMHPRVLVD
GFEIAKRATLQFLDTFKTPVVMGDEPDKEILKMVARTTLRTKLYEGLADQLTDIVVNSVL
CIRKPQEPIDLFMVEIMHMRHKFDVDTRLVEGLVLDHGSRHPDMKRRAENCHILTCNVSL
EYEKSEINAGFFYSNAEQREAMVTAERRSVDERVQKIIELKNKVCAGNDNSFVILNQKGI
DPPSLDLLAREGIIALRRAKRRNMERLVLACGGEAVNSVDDLTPDCLGWAGLVYEHVLGE
EKYTFVEQVKNPHSCTILIKGPNDHTIAQIKDAVRDGLRSVKNTLEDECVVLGAGAFEVA
ARQHLINEVKKTVQGRAQLGVEAFANALLVVPKTLAENAGLDTQDVIISLTSEHDKGNIV
GLDLQDGEPVDPQLAGIFDNYSVKRQLINSGPVIASQLLLVDEVIRAGRNMRKPT

MSVRVLNPNAEVLNKSAALHMTINAAKGLQDVLKSNLGPKGTIKMLVGGSGDIKLTKDGN
TLLKEMQIQNPTAIMIARTAVAQDDISGDGTTSTVIFIGELMKQSERCIDEGMHPRVLVD
GFEIAKRATLQFLDNFKTPVVMGDEVDKEILKMVARTTLRTKLYEGLADQLTDIVVNSVL
CIRKPEEAIDLFMVEIMHMRHKFDVDTRLVEGLVLDHGSRHPDMKRRAENCHILTCNVSL
EYEKSEINAGFFYSNAEQREAMVTAERRSVDERVKKIIELKKKVCGDNDNFVVINQKGID
PPSLDLLAREGIIGLRRAKRRNMERLVLACGGEAVNSVDDLTPESLGWAGLVYEHVLGEE
KYTFVEQVKNPNSCTILIKGPNDHTIAQIKDAVRDGLRSVKNTIEDECVVLGAGAFEVAA
RQHLLNEVKKTVQGRAQLGVEAFANALLVVPKTLAENAGLDTQDVIISLTSEHDKGNVVG
LNLQDGEPIDPQLAGIFDNYSVKRQLINSGPVIASQLLLVDEVIRAGRNMRKPTA

www.000webhost.com

Other information
Ka divergence:0.107087KaKs divergence:0.0242991
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1608Length 2 (bp):1608Length divergence:0
MFE 1 (kcal):-496.6MFE 2 (kcal):-490.99MFE divergence-0.006