Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02555-AT5G16110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.2474259110795
Log2 mRNA fold difference:1.4234881035141
Log2 TE fold difference:0.83245186129456
Sequences
Protein sequence

MNHCSLQQNAFLSREESRGFVPIYSHPVDSVVCPKPRRANNVIRPFRLHFSLSGADDVCD
SKAGEDLLDIFRRKESVSSRSPPFFLGSPPSRAANPLAQDARFGDEKLNTVSPSLSPLLP
SASRVKSGCGRMKFGVKPATVRVEGFDCLNRDRPNSSIPAMA

MLSSTSPTLSSVSSFYKIPISSNDFSPLSLSLSLSLFLLSSPSSFSLSPLPEIFTQAFFC
GSEVKKMNHCNLQQNAFMSREEMMGFDRKDLVVCPKPRRVGLLANNVIRPLRLHMSQAAA
DLCDSKAGAELLEIIRRKEDNGTIGQLLSSSPPYFPGSPPSRAANPLAQDARFRDEKLNP
ISPNSPFLQPYSATGFPSPSSSSSSSSSRGCVRMKFGLNSPAVRVEGFDCLNRDRQNSSI
PAMA

www.000webhost.com

Other information
Ka divergence:-0.201883KaKs divergence:-0.063911
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):489Length 2 (bp):735Length divergence:0.201
MFE 1 (kcal):-138.19MFE 2 (kcal):-192.51MFE divergence0.164