Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02610-AT3G02620
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Plant stearoyl-acyl-carrier-protein desaturase family protein
Function (paralog2):Plant stearoyl-acyl-carrier-protein desaturase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.0352114632206
Log2 mRNA fold difference:2.3761168199205
Log2 TE fold difference:-0.35370953564005
Sequences
Protein sequence

MKMALLLNSTITVAMKQNPLVAVSFPRTTCLGSSFSPPRLLRVSCVATNPSKTSEETDKK
KFRPIKEVPNQVTHTITQEKLEIFKSMENWAQENLLSYLKPVEASWQPQDFLPETNDEDR
FYEQVKELRDRTKEIPDDYFVVLVGDMITEEALPTYQTTLNTLDGVKDETGGSLTPWAVW
VRAWTAEENRHGDLLNKYLYLSGRVDMRHVEKTIQYLIGSGMDSKFENNPYNGFIYTSFQ
ERATFISHGNTAKLATTYGDTTLAKICGTIAADEKRHETAYTRIVEKLFEIDPDGTVQAL
ASMMRKRITMPAHLMHDGRDDDLFDHYAAVAQRIGVYTATDYAGILEFLLRRWEVEKLGM
GLSGEGRRAQDYLCTLPQRIRRLEERANDRVKLASKSKPSVSFSWIYGREVEL

MALLLNSTMTVAMKQNPATAVSFMQTTCLGSSFSPPRHLQVSCVATNPSKTFRPIKEVSN
QVTHTITQEKLEIFKSMENWAQENLLSYLKPVETSWQPQDFLPETKDEDRFYEQVKELRD
RTKEIPDDYFVVLVGDMITEEALPTYQTVMNTLDGAKDETGVSLTPWAVWLRAWTAEENR
HGDLLNKYLYLSGRVDTRHVEKTIQYLIGSGMDTKYENNPYNGYIYTSFQERATFISHAN
TAKLATTYGDTTLAKICGTIAADEKRHEMAYTRIVEKLFEIDPDGTVQALASMMRKRITM
PAQLMHDGRDDNLFDHYAAVAQRIGVYTATDYAGILEFLLRRWEVEKLGMGLSGEGRRAQ
DYLCTLPQRIRRLEERADDRVKRASKSKPSVSFSWIYGREVEL

Other information
Ka divergence:0.508281KaKs divergence:-0.976648
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1242Length 2 (bp):1212Length divergence:-0.012
MFE 1 (kcal):-390.82MFE 2 (kcal):-370.51MFE divergence-0.027