Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02610-AT5G16230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant stearoyl-acyl-carrier-protein desaturase family protein
Function (paralog2):Plant stearoyl-acyl-carrier-protein desaturase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.0059268620118
Log2 mRNA fold difference:-0.9454056933326
Log2 TE fold difference:-1.0410012127089
Sequences
Protein sequence

MKMALLLNSTITVAMKQNPLVAVSFPRTTCLGSSFSPPRLLRVSCVATNPSKTSEETDKK
KFRPIKEVPNQVTHTITQEKLEIFKSMENWAQENLLSYLKPVEASWQPQDFLPETNDEDR
FYEQVKELRDRTKEIPDDYFVVLVGDMITEEALPTYQTTLNTLDGVKDETGGSLTPWAVW
VRAWTAEENRHGDLLNKYLYLSGRVDMRHVEKTIQYLIGSGMDSKFENNPYNGFIYTSFQ
ERATFISHGNTAKLATTYGDTTLAKICGTIAADEKRHETAYTRIVEKLFEIDPDGTVQAL
ASMMRKRITMPAHLMHDGRDDDLFDHYAAVAQRIGVYTATDYAGILEFLLRRWEVEKLGM
GLSGEGRRAQDYLCTLPQRIRRLEERANDRVKLASKSKPSVSFSWIYGREVEL

MSMALLLTSPAMKQKPAVITSPRRGSSPSRRLRVSCVTTNPARKKNETCNHFRPIKEVNN
QLTHTIPQEKLEIFKSMENWAEQKLLPYLKPVEDSWQPQDFLPAPENDDEFYDRVKEIRE
RTKEIPDDYFVVLVGDMITEEALPTYQTTLNTLDGVKDETGGSLSPWAVWIRAWTAEENR
HGDLLNKYLYLTGRVDMRHVEKTIQYLIGSGMDSKFENNPYNGFIYTSFQERATFISHGN
TARLATTYGDVTLAKICGTIAADEKRHETAYTKIVEKLFEIDPDGSVQALASMMKKRITM
PAHLMHDGRDNDLFDHYAAVAQRIGVYTAADYAGILEFLLRRWKVESLGLGLSGEGRRAQ
EYLCTLPQRIKRLEERANDRVKLVSKPSVSFSWVFGRDVKL

www.000webhost.com

Other information
Ka divergence:0.203262KaKs divergence:0.999776
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1242Length 2 (bp):1206Length divergence:-0.015
MFE 1 (kcal):-390.82MFE 2 (kcal):-365.6MFE divergence-0.033