Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02640-AT5G16250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.49528963319761
Log2 mRNA fold difference:1.0667805667626
Log2 TE fold difference:-0.40845307095835
Sequences
Protein sequence

MGLIPQPQESIQESHYYTHKLFLTANYVLLGASSSCIFLTLSLRLIPSLCGFFLILLHAT
TIAAAVSGCAAASYGKNRWYAAHMIATVLTAIFQGSVSVLIFTNTSNFLESLNSYVREKE
ASMILKLAGGLCVVIFCLEWIVLVLAFFLKYYAYVDGDNNGVAMKRTGKVQSEETLKNSP
WAFQV

MGFISSSSPVEESHYHTHKIFLFSNYILLGAASSCIFLTLSLRLIPSICGFLLILLHATT
IAAAVSGCAAASCGRNRWYAAHMVATVLTAIFQGSVSVLIFTNTSKFLGSLKSYVREEDA
AVILKLGGGLCIVIFCLDWIVLVCAFFLKYYAYVDGGDGVAMKRTGKVQSEENPKDWPWP
FQV

Other information
Ka divergence:-0.145324KaKs divergence:0.999845
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):558Length 2 (bp):552Length divergence:-0.005
MFE 1 (kcal):-142.06MFE 2 (kcal):-152.85MFE divergence0.037