Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02700-AT5G16360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NC domain-containing protein-related
Function (paralog2):NC domain-containing protein-related

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.6090425814066
Log2 mRNA fold difference:-2.3810654926503
Log2 TE fold difference:-0.44360554993558
Sequences
Protein sequence

MGFLSNKISRDDVKPGDHIYSWRQAYIYAHHGIYVGNGQVNHFTRGDGQETGTGTFLDNI
IVSSSHNHGDNPCPDCGDRSNLGGVISSCLECFLAGGDLYVFEYSVSPAIFLAKPRGGVC
TIASSDPPEEVIYRANFLLQNGFGVYNVFKNNCEDFAIYCKTGLLVANTDVGRSGQAASI
VAAASVLLSSPLRFVAGFGGLAVAGYGMYCTSRLVSDIGMRWDVSKVPVERLVADVACMS
DMEAKPEDEKTT

MGLFSHKISRDDLKPGDHIYSWRNAYIYSHHGVYVGDEKVIHFTRGGGLEFGTGTVLDKI
IDISIPNHGRRDKKCIDCGDQSNLGGVISSCLDCFLAGGNLHLFEYSASPSIFLAKRGGT
CTIASSDPCDEVISRAKFLLLQNGFGEYDLLDNNCEDFAIYCKTGLFVLSVATKFGCSGQ
ANSVSAAGGVVALTLKVLGVKKKSSSGHEDDSVVSVVNQFISSTVKYVVPGIGGLALAEY
GNYCIGRLFYDIGVRKDACKVSVEELVAFVGAKQNILEGKKSN

www.000webhost.com

Other information
Ka divergence:0.388104KaKs divergence:-0.999704
GC content 1 (%):45GC content 2 (%):40GC content divergence:-0.059
Length 1 (bp):759Length 2 (bp):852Length divergence:0.058
MFE 1 (kcal):-233.9MFE 2 (kcal):-242.44MFE divergence0.018