Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02730-AT5G16400
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):thioredoxin F-type 1
Function (paralog2):thioredoxin F2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0190832106922
Log2 mRNA fold difference:-2.322428479377
Log2 TE fold difference:0.35507744274873
Sequences
Protein sequence

MPLSLRLSPSPTALSPTTGGFGPSRKQCRIPYSGVPTTKIGFCSLDSRKRGDSSVVRCSL
ETVNVSVGQVTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVV
FLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDDLVAAIETARSAASG

MPLSLRLAPSPTSFRYSPITSTGAGGFSPVKQHCRIPNSGVATKIGFCSGGGGVLDSGRR
IGSCVVRCSLETVNVTVGQVTEVDKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYK
ELSEKYQDMVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIE
AARSG

www.000webhost.com

Other information
Ka divergence:0.23449KaKs divergence:0.993623
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):537Length 2 (bp):558Length divergence:0.019
MFE 1 (kcal):-173.3MFE 2 (kcal):-183.6MFE divergence0.029