Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02770-AT5G16450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase
Function (paralog2):Ribonuclease E inhibitor RraA/Dimethylmenaquinone methyltransferase

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.88401860997018
Log2 mRNA fold difference:-1.5754371913694
Log2 TE fold difference:0.70020652623376
Sequences
Protein sequence

MAFVTTAEVCDANQEMIRSGQLRALQPVFQIYGRRQIFSGPVVTVKVFEDNGLIRHFLEE
KGNGRVLVVDGGGSLRCAILGGNPVVQAQNNGWAGIIVNGCIRDVDEINGCDIGVRALAS
HPIKASKKGLGEQRVSLNIAGTRICDGEWLYADTDGILVSQIELSV

MAFVTTAEVCDANQELIRSGQLRALQPIFQIYGRRQIFSGPVVTVKVFEDNGLIRQFIEE
KGNGRVLVVDGGGSQRCAILGGNPVVQAQNNGWAGIVVNGCIRDVDEINGCDIGVRALAS
HPIKASKKGLGEQRVPVNIAGTRICDGEWLYADTDGILVSQIELSV

www.000webhost.com

Other information
Ka divergence:-0.45694KaKs divergence:0.99995
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):501Length 2 (bp):501Length divergence:0
MFE 1 (kcal):-158.1MFE 2 (kcal):-158.1MFE divergence0