Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02780-AT5G16440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase 2
Function (paralog2):isopentenyl diphosphate isomerase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.68916555095103
Log2 mRNA fold difference:-0.44638875063539
Log2 TE fold difference:-0.17851770363664
Sequences
Protein sequence

MSASSLFNLPLIRLRSLALSSSFSSFRFAHRPLSSISPRKLPNFRAFSGTAMTDTKDAGM
DAVQRRLMFEDECILVDETDRVVGHDSKYNCHLMENIEAKNLLHRAFSVFLFNSKYELLL
QQRSNTKVTFPLVWTNTCCSHPLYRESELIQDNALGVRNAAQRKLLDELGIVAEDVPVDE
FTPLGRMLYKAPSDGKWGEHELDYLLFIVRDVKVQPNPDEVAEIKYVSREELKELVKKAD
AGEEGLKLSPWFRLVVDNFLMKWWDHVEKGTLVEAIDMKTIHKL

MSTASLFSFPSFHLRSLLPSLSSSSSSSSSRFAPPRLSPIRSPAPRTQLSVRAFSAVTMT
DSNDAGMDAVQRRLMFEDECILVDENDRVVGHDTKYNCHLMEKIEAENLLHRAFSVFLFN
SKYELLLQQRSKTKVTFPLVWTNTCCSHPLYRESELIEENVLGVRNAAQRKLFDELGIVA
EDVPVDEFTPLGRMLYKAPSDGKWGEHEVDYLLFIVRDVKLQPNPDEVAEIKYVSREELK
ELVKKADAGDEAVKLSPWFRLVVDNFLMKWWDHVEKGTITEAADMKTIHKL

www.000webhost.com

Other information
Ka divergence:-0.0904613KaKs divergence:-0.33135
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):855Length 2 (bp):876Length divergence:0.012
MFE 1 (kcal):-260.9MFE 2 (kcal):-271.3MFE divergence0.02