Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02790-AT5G16470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc finger (C2H2 type) family protein
Function (paralog2):zinc finger (C2H2 type) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.1587972175648
Log2 mRNA fold difference:2.0627685955627
Log2 TE fold difference:2.0048288599968
Sequences
Protein sequence

MTGKAKPKKHTAKEIQAKIDAALTNRGGGKAGIADRTGKEKGGHAKYECPHCKITAPGLK
TMQIHHESKHPNIIYEESKLVNLHAVLAPVAESKPKPGIRGSLKK

MTGKAKPKKHTAKELQAKADAALTNRGGGKAGLADRTGKEKGGHAKYECPHCKITVPDLK
TMQIHHESKHPKLTYEEPRNLHEALAAPAESSKPKPGIRGSLKK

www.000webhost.com

Other information
Ka divergence:0.0113418KaKs divergence:0.0518697
GC content 1 (%):46GC content 2 (%):50GC content divergence:0.042
Length 1 (bp):318Length 2 (bp):315Length divergence:-0.005
MFE 1 (kcal):-92.05MFE 2 (kcal):-97.6MFE divergence0.029