Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02800-AT5G16480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tyrosine phosphatase family protein
Function (paralog2):Phosphotyrosine protein phosphatases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.22283919840072
Log2 mRNA fold difference:0.15672791752366
Log2 TE fold difference:-0.025084366646951
Sequences
Protein sequence

MCLIMETDDHNGDVLAPPSNFSMVEDGIYRSGFPRPENFSFLKTLNLRSIIYLCPEPYPE
ENLKFLEANNIKLYQFGIEGKTDPPTPMPKDTVLDALKVLVDVRNHPILIHCKRGKHRTG
CLVGCLRKVQSWCLSSVLEEYQKNAGLKWRQRDLNFIEAFDIVSLRQCLLSIMYQYHGYG
FKRRRLAYEEENVKTPKPQAARV

MGLIVDDDNDGEVLIPPPNFSMVEDEIYRSGFPELENFGFLSTLNLRSIIYLCPEPYPED
NLKSLASNNIKLFQFGIEGKTDPPTPMPKDTVLSALRVLVDVRNHPILIHCKRGKHRTGC
LVGCLRKVQNWCLSSVLEEYQKCAGLKWRQRDLRFIEDFDVLRLKQCLYSIIYQYNGYGL
KRRKLLYQEENVVQEQQKPQATKG

www.000webhost.com

Other information
Ka divergence:0.151194KaKs divergence:-0.102582
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):612Length 2 (bp):615Length divergence:0.002
MFE 1 (kcal):-174.6MFE 2 (kcal):-176.9MFE divergence0.007