Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02830-AT5G16540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):zinc finger protein 1
Function (paralog2):zinc finger nuclease 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.5417752532581
Log2 mRNA fold difference:-2.2902263746304
Log2 TE fold difference:-0.047255372492248
Sequences
Protein sequence

MDFNAGVPMSSLSPLMNQDAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGST
CRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGR
VSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFNHPQPQPTNMMVPTSGQQSYPWSRAS
FIASPRWQDPSSYASLIMPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRNLQQNETIES
GSQSQGSFSGYNPGSSVPLGGYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHP
RDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASETD
EVVETSTGKSRRLSVSETRQAATTSSGKDTTIDNTQQ

MDFDSISRESTFLSPLLNQNAMWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFG
STCRFNHPHDRKLVIATARIKGEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGID
GSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVSVRGSPVYSALQ
SLTGQPSYSWSRTSFVANPPRLQDPSGFASGSQGGLFSSGFHSGNSVPLGFYALPRENVF
PERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSR
YGICKFGPSCKFDHPMRVFTYNNNTASPSPSSSLHQETAITTELRNLLVSSSVEAKPTSL
PETTSAKDTIVDAQH

Other information
Ka divergence:0.381846KaKs divergence:0.310022
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1194Length 2 (bp):1128Length divergence:-0.028
MFE 1 (kcal):-364.8MFE 2 (kcal):-321.8MFE divergence-0.063