Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02880-AT5G16590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.22565032136507
Log2 mRNA fold difference:-0.029125251015828
Log2 TE fold difference:0.25794489578093
Sequences
Protein sequence

MKYKRKLSLSVVFLFVFYLAAVTSDLESDRRALLAVRNSVRGRPLLWNMSASSPCNWHGV
HCDAGRVTALRLPGSGLFGSLPIGGIGNLTQLKTLSLRFNSLSGPIPSDFSNLVLLRYLY
LQGNAFSGEIPSLLFTLPSIIRINLGENKFSGRIPDNVNSATRLVTLYLERNQLSGPIPE
ITLPLQQFNVSSNQLNGSIPSSLSSWPRTAFEGNTLCGKPLDTCEAESPNGGDAGGPNTP
PEKKDSDKLSAGAIVGIVIGCVVGLLLLLLILFCLCRKRKKEENVPSRNVEAPVAAATSS
AAIPKETVVVVPPAKATGSESGAVNKDLTFFVKSFGEFDLDGLLKASAEVLGKGTVGSSY
KASFEHGLVVAVKRLRDVVVPEKEFRERLHVLGSMSHANLVTLIAYYFSRDEKLLVFEYM
SKGSLSAILHGNKGNGRTPLNWETRAGIALGAARAISYLHSRDGTTSHGNIKSSNILLSD
SYEAKVSDYGLAPIISSTSAPNRIDGYRAPEITDARKISQKADVYSFGVLILELLTGKSP
THQQLNEEGVDLPRWVQSVTEQQTPSDVLDPELTRYQPEGNENIIRLLKIGMSCTAQFPD
SRPSMAEVTRLIEEVSHSSGSPNPVSD

MKNKTNLGLSVFFFFICLVSVTSDLEADRRALIALRDGVHGRPLLWNLTAPPCTWGGVQC
ESGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQG
NAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEIKI
KLQQFNVSSNQLNGSIPDPLSGMPKTAFLGNLLCGKPLDACPVNGTGNGTVTPGGKGKSD
KLSAGAIVGIVIGCFVLLLVLFLIVFCLCRKKKKEQVVQSRSIEAAPVPTSSAAVAKESN
GPPAVVANGASENGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKA
SFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSR
GSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESF
EAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTH
QQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSR
PTMPEVTRLIEEVSRSPASPGPLSD

www.000webhost.com

Other information
Ka divergence:-0.0516848KaKs divergence:-0.216778
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1884Length 2 (bp):1878Length divergence:-0.002
MFE 1 (kcal):-619.33MFE 2 (kcal):-604.4MFE divergence-0.012