Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02890-AT5G16680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/FYVE/PHD zinc finger superfamily protein
Function (paralog2):RING/FYVE/PHD zinc finger superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.54789152687358
Log2 mRNA fold difference:0.44487886572011
Log2 TE fold difference:0.097482177395529
Sequences
Protein sequence

MADRRVGNRPMGRRGRLEIQSGTCNVCSAPCSSCMHHNAEFSGSKSDESSDENSHGVLAS
QCSFNGDNLLRSSGVNAPGSSHNTSSEASHLVNSNHDTSSENAESKEIIRSSDISHGPLL
DRPHKDQDSMKVDSCNDHQARSTLGQGKVKEKSGAKNNEEKKNTLTGSSKHSGPRVGKSG
ENVLLNKADESNTSAMSDSESENDPEMLELDVKVCDTCGDAGREDLLAICSRCSDGAEHT
YCMRVMLKKVPKGYWLCEECKFAEKAEKHKLETKRKRESEVNVNTQISSKRHIDKFEAVP
DSKRLAVGAQIGSPKRSVLPRMSTLSRETSFKGLEKPTRKLAHYSSFNSHSSDDTESTRS
TDSQLQSPKGSFLKSNSFNSLSSRSKVRPVDDDMLPRQKTGNENSSLEVKEGFSKNVGKS
MSSRCIDVGSSNCNDSKVKGSKQLKDWSTEANPSASISRGNSSIPYAKSPRDLKDLQSDG
KQGSLSKQARHLSRNRLEDIVASVGDSSKNEKCSSSEQISSEAKCKDELAQVDGVPRSRE
FREAGEKTKDAVGNHQKRNIGEDNNKGNRLRAAVDAALRKKPSFSKNRGLEQSDLPPVSN
VDSGCNKALKCLSSKVPVIRDWPVGFQGLPGGHPNLRTDKQTNTVNEKQFTLAGTDATTA
SQSVEPEVNDPSVQSVMRDLPVAAPNVLSTTSAIPKPEYIWQGDLEVQKSRNLSAMHSGI
QAYLSTLASPKVVEVVKQFPEKVTLNEVPRLSSWPAQFQDTGAKEQHVALFFFAKDIESY
EKNYKPLVDNMIQKDLALKGNLEGVELLIFASNQLPQDCQRWNMLFFLWGVFRGKKESCS
NPPKNTPLPASCVSPNRDTFRHENPSNKKSLTDRTLSRMQSCMKEEDAKEGKACSGTEKE
NAFSVSYGEGEVDVETEEGEIGVSPQLKYEKTAGPGTVKSADMNQRVNVDDLNKEGLCEG
PANKKLKTVTGVETGCSIVRRDTSVHKFASRKFV

MADRRVGKRQMGQRGFSKVESGTCNVCSAPCSSCMHRNVGFTGSKLDESSDENCHGVVGS
QCSVNEDDLLPSSMVNAHKSLNNTASEASNLVNSSHDALSENAESKETIRCSGISDDSGA
AAMTSKPSLSGSRMKHKVSASANMLDQSSNCIEDQEDGILSADRAKQLKSGCSNNEIGNK
DLADGSALNSDPIPGGSRKDEVKLESLQNPSSNHDDRVSSEKGNFKEKSRPGGNKERQEP
SVEGSTRSGENRKDGKSSKSSSSNSSAVSESESDDSEMVEHDVKVCDICGDAGREDLLAI
CSGCSDGAEHTYCMREMLDEVPEGDWLCEECAEEAEKQKQEAKRKRETEVTFNTYSSGKR
HADKIEAAPDAKRQVVEASTGSPKKSILPRVGALSRETSFKGLDRLRGKLNHQTSFSDDT
ESARSAGSQLQPPKGAFLKSSSFNCSSSKPKVQLMDDAIHPRQKTGKEDTALDLKVGGFR
NVGKSMPSRTTDAGNSGGSDSQAKMLGSKVYHSQEGKSLKQVKDRNREANASASSIDQKL
KSRGNSSVSHANNNRDLKGLQSDGKRGNLTKQVSNLSRNRLENSVVSGGDISTNEKCSAS
EQSSSQADCKDELPSTSCTGEGMPNHGTVALQDGLPRSRVPREVGKKSKEAFSKRQRSSL
LAGAKGLPSSQKGGQTAESSDTSGVSDSDLSTTKNVKEDLNKGNRLRAAVDAALRKKPSF
GKNRVLEQSDASLVANVDSSSEKTLRNQLPSKMHKNHVSHEGLQGGHPILWPTSDPYKQT
IVTNEKQLIFPGADTIPSRLVEPEVSFPAVKPVMRDLPLVPSPVMLRSSAIPDHEFIWQG
DLEVRKIINQSAMHSGIQAHLSTLASPRVAEVVNKFPETFSLNEVPRKSTWPTQFEKLGT
KEAHIALFFFAKDTESYERNYKPLVDNMIKNDLALKGNLDNVDLLIFASNQLPSNCQRWN
MLYFLWGVFQGRKETNPQKNTSLPTSNVLPRDRDPKELCQTSSPSKHLEKGSSLRESSSN
GIETRNGTDARSHENPNNRESSIERSPSKKEDIALKVEEAGVNHIPPQVTGSNSGDSLVR
KVQKVEEQELGGRKDLPLTVMGSGIQSHGQDNPLEKDLNSSQASHRKRPLWELSNPANEN
SSAINQKVELNNDGLCEGSPNKKLKTENGSSSLCRDTSGHDSGIMKKSPKVVFPLDLNDD
SEMVDNLSPLGNDENNNNRRLISGTVPNLELALGAEETTEATMGLLPFLSRSSNSGEQSN
NSMNKEKQKADEEEEDDAEVAASLSLSLSFPGTEERKNVNTPLFLFRDLPR

www.000webhost.com

Other information
Ka divergence:-0.177585KaKs divergence:0.26801
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2985Length 2 (bp):3936Length divergence:0.137
MFE 1 (kcal):-889.91MFE 2 (kcal):-1190.11MFE divergence0.144