Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02900-AT5G16660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.8486482783146
Log2 mRNA fold difference:1.6906881031369
Log2 TE fold difference:0.16466538532309
Sequences
Protein sequence

MASLVAAPISFSGDSHVKAHRNFNAIRKSSTLTVQTKSNRSHKLSVSAGYRGGSKGGGSS
DFVTGFLLGSAVFGTLAYIFAPQIRRSVLSENEYGFKKPEQPMYYDEGLEERREILNEKI
GQLNSAIDKVSSRLKGGRSGSSKNTSSPSVPVETDAEAEATA

MASCIATAPLSLSGVSQSHYVKANGLSTTTKLSSICKTSDLTIHKKSNRTRKFSVSAGYR
DGSRSGSSGDFIAGFLLGGAVFGAVAYIFAPQIRRSVLNEEDEYGFEKPKQPTYYDEGLE
KTRETLNEKIGQLNSAIDNVSSRLRGREKNTSSLNVPVETDPEVEATT

www.000webhost.com

Other information
Ka divergence:-0.253786KaKs divergence:0.680851
GC content 1 (%):47GC content 2 (%):42GC content divergence:-0.056
Length 1 (bp):489Length 2 (bp):507Length divergence:0.018
MFE 1 (kcal):-150.4MFE 2 (kcal):-138.93MFE divergence-0.04