Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02930-AT5G16730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF827)
Function (paralog2):Plant protein of unknown function (DUF827)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.424664519637
Log2 mRNA fold difference:2.3041470026916
Log2 TE fold difference:-0.093073690790563
Sequences
Protein sequence

MASKIKNGLSDTTLRKSSSTSLRVPRLTRIVTKPDSNSPSPTQQQSRLSFERPSSNSKPS
TDKRSPKAPTPPEKTQIRAVRVSESQPQSVQIKEDLKKANELIASLENEKAKALDQLKEA
RKEAEEASEKLDEALEAQKKSLENFEIEKFEVVEAGIEAVQRKEEELKKELENVKNQHAS
ESATLLLVTQELENVNQELANAKDAKSKALCRADDASKMAAIHAEKVEILSSELIRLKAL
LDSTREKEIISKNEIALKLGAEIVDLKRDLENARSLEAKVKELEMIIEQLNVDLEAAKMA
ESYAHGFADEWQNKAKELEKRLEEANKLEKCASVSLVSVTKQLEVSNSRLHDMESEITDL
KEKIELLEMTVASQKVDLEKSEQKLGIAEEESSKSEKEAEKLKNELETVNEEKTQALKKE
QDATSSVQRLLEEKKKILSELESSKEEEEKSKKAMESLASALHEVSSESRELKEKLLSRG
DQNYETQIEDLKLVIKATNNKYENMLDEARHEIDVLVNAVEQTKKQFESAMVDWEMREAG
LVNHVKEFDEEVSSMGKEMNRLGNLVKRTKEEADASWEKESQMRDCLKEVEDEVIYLQET
LREAKAETLKLKGKMLDKETEFQSIVHENDELRVKQDDSLKKIKELSELLEEALAKKHIE
ENGELSESEKDYDLLPKVVEFSEENGYRSAEEKSSKVETLDGMNMKLEEDTEKKEKKERS
PEDETVEVEFKMWESCQIEKKEVFHKESAKEEEEDLNVVDQSQKTSPVNGLTGEDELLKE
KEKKKKKTLFGKVGNLLKKKGPVNQK

MASKTKTSLSETTTTTTPTGKSSPATPRIAKRTVNKSETSNNNSPSTTTPHSRLSLDRSS
PNSKSSVERRSPKLPTPPEKSQARVAAVKGTESPQTTTRLSQIKEDLKKANERISSLEKD
KAKALDELKQAKKEAEQVTLKLDDALKAQKHVEENSEIEKFQAVEAGIEAVQNNEEELKK
ELETVKNQHASDSAALVAVRQELEKINEELAAAFDAKSKALSQAEDASKTAEIHAEKVDI
LSSELTRLKALLDSTREKTAISDNEMVAKLEDEIVVLKRDLESARGFEAEVKEKEMIVEK
LNVDLEAAKMAESNAHSLSNEWQSKAKELEEQLEEANKLERSASVSLESVMKQLEGSNDK
LHDTETEITDLKERIVTLETTVAKQKEDLEVSEQRLGSVEEEVSKNEKEVEKLKSELETV
KEEKNRALKKEQDATSRVQRLSEEKSKLLSDLESSKEEEEKSKKAMESLASALHEVSSEG
RELKEKLLSQGDHEYETQIDDLKLVIKATNEKYENMLDEARHEIDVLVSAVEQTKKHFES
SKKDWEMKEANLVNYVKKMEEDVASMGKEMNRLDNLLKRTEEEADAAWKKEAQTKDSLKE
VEEEIVYLQETLGEAKAESMKLKENLLDKETEFQNVIHENEDLKAKEDVSLKKIEELSKL
LEEAILAKKQPEEENGELSESEKDYDLLPKVVEFSSENGHRSVEEKSAKVETLDHEPPQE
QISNGNSNGNGMEEKEVNGKPEVETEKKEKKDESQDDDKDDSVEVIFKMWESCQIEKKEA
FPDKKSELESQEEEEDSSKIDESDKTSTENIDETGNALTAEDQLTMEKKIKKKKTLLGKV
GNLLKKKAPVNQK

Other information
Ka divergence:-0.0609209KaKs divergence:0.100045
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):2421Length 2 (bp):2562Length divergence:0.028
MFE 1 (kcal):-646.42MFE 2 (kcal):-708.4MFE divergence0.046