Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02950-AT5G16790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tho complex subunit 7/Mft1p
Function (paralog2):Tho complex subunit 7/Mft1p

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.0606716566335
Log2 mRNA fold difference:-3.4137269810131
Log2 TE fold difference:-0.62881844009928
Sequences
Protein sequence

MSVKARRISGRLETVVTKVNYAFDPVDDDKIIRNRLLTRTTTTRGEPPLKKLQKKFTSFV
LEVDKEEENYNDCGRLAKAFLQELSTFEIPLLKSQAVVEANLREKESFNEVKDETERQIM
QAKAEIEDLKKQLEESKIDRQHKEECETIRKLISAQPPRSETEKVIYELNKEIAELEAES
TASWRLLELRKKQFALLMHVVDELQNTMEDEQKSLVDEIRSASEDQRNITDAMSVD

MSVRARRIVSGRSETVAANYAFDPLHDDKIIRNRLLTRTTTTRGEPPLKKLQKKFTSFVI
ELDKEEDNYSECGRLAKAFLQELSAFEIPLLKSQVVVAANLREKENFNELKDETNRQIMQ
AQADIEDLKKQLEESKIERQQKEECEAIRKLISAQPPRSETQKVIHELKKEIAELEAENT
ASWRLLELRKKQFALLLHVVDELQETMEDEQKSMVEEMQRNITADGAEAMSID

www.000webhost.com

Other information
Ka divergence:-0.0966201KaKs divergence:0.343103
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):711Length 2 (bp):702Length divergence:-0.006
MFE 1 (kcal):-191.2MFE 2 (kcal):-192MFE divergence0.002