Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02990-AT5G16820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):heat shock transcription factor A1E
Function (paralog2):heat shock factor 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.0608390727001
Log2 mRNA fold difference:2.3192255950339
Log2 TE fold difference:-0.23373804049474
Sequences
Protein sequence

MGTVCESVATAKSSTAVMSSIPPFLSKTYDMVDDPLTDDVVSWSSGNNSFVVWNVPEFAK
QFLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKQILKSIVRRKPAQVQP
PQQPQVQHSSVGACVEVGKFGLEEEVERLQRDKNVLMQELVRLRQQQQVTEHHLQNVGQK
VHVMEQRQQQMMSFLAKAVQSPGFLNQFSQQSNEANQHISESNKKRRLPVEDQMNSGSHG
VNGLSRQIVRYQSSMNDATNTMLQQIQQMSNAPSHESLSSNNGSFLLGDVPNSNISDNGS
SSNGSPEVTLADVSSIPAGFYPAMKYHEPCETNQVMETNLPFSQGDLLPPTQGAAASGSS
SSDLVGCETDNGECLDPIMAVLDGALELEADTLNELLPEVQDSFWEQFIGESPVIGETDE
LISGSVENELILEQLELQSTLSNVWSKNQQMNHLTEQMGLLTSDALRK

MESVPESVPSPNSNTPSIPPPVNSVPPFLSKTYDMVDDPLTNEVVSWSSGNNSFVVWSAP
EFSKVLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGRKQLLKSIVRRKPS
HVQQNQQQTQVQSSSVGACVEVGKFGIEEEVERLKRDKNVLMQELVRLRQQQQATENQLQ
NVGQKVQVMEQRQQQMMSFLAKAVQSPGFLNQLVQQNNNDGNRQIPGSNKKRRLPVDEQE
NRGDNVANGLNRQIVRYQPSINEAAQNMLRQFLNTSTSPRYESVSNNPDSFLLGDVPSST
SVDNGNPSSRVSGVTLAEFSPNTVQSATNQVPEASLAHHPQAGLVQPNIGQSPAQGAAPA
DSWSPEFDLVGCETDSGECFDPIMAVLDESEGDAISPEGEGKMNELLEGVPKLPGIQDPF
WEQFFSVELPAIADTDDILSGSVENNDLVLEQEPNEWTRNEQQMKYLTEQMGLLSSEAQR
K

www.000webhost.com

Other information
Ka divergence:-0.0472909KaKs divergence:-0.0279242
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1407Length 2 (bp):1446Length divergence:0.014
MFE 1 (kcal):-439.1MFE 2 (kcal):-424.27MFE divergence-0.017