Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03010-AT5G16870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peptidyl-tRNA hydrolase II (PTH2) family protein
Function (paralog2):Peptidyl-tRNA hydrolase II (PTH2) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3137750455165
Log2 mRNA fold difference:0.11858469564689
Log2 TE fold difference:-1.330207743109
Sequences
Protein sequence

MDLVWLLSVLLVGAALGYYISTLRQTRRIFLSSKSVAIDAGSSGNKKTKSKEPLEIEKLA
DFRKNFKMVLVVRNDLKMGKGKIAAQCSHATLGLYKKLLQRAPKALNRWEYCAQPKVVVK
IESEEEMLVLQERAKTLKLPTHITIDAGKTQIAPNSRTVMAILGPVDNVDEVTGGLKLM

MDLTWLSALIVGAALGYCIGTRRSKPVVAAVDKDIKTQSSKSPLEIEKLADILDDFKMVL
VVRNDLKMGKGKIAAQCSHATLGLYKKLVRRAPKALDCWEECAQPKVVVKIEDEDEMLEL
QERAKSLKLPTHITIDAGRTQIAPNSRTVMAILGPVEVVDEVTGGLKLL

www.000webhost.com

Other information
Ka divergence:-0.0638872KaKs divergence:-0.47543
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):540Length 2 (bp):510Length divergence:-0.029
MFE 1 (kcal):-140.3MFE 2 (kcal):-136.7MFE divergence-0.013