Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03050-AT5G16910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cellulose synthase-like D3
Function (paralog2):cellulose-synthase like D2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.76038905481977
Log2 mRNA fold difference:-0.077014629558041
Log2 TE fold difference:-0.78204591432479
Sequences
Protein sequence

MASNNHFMNSRSNLSTNSDAAEAERHQQPVSNSVTFARRTPSGRYVNYSRDDLDSELGSV
DLTGYSVHIPPTPDNQPMDPSISQKVEEQYVSNSLFTGGFNSVTRAHLMEKVIDTETSHP
QMAGAKGSSCAVPGCDVKVMSDERGQDLLPCECDFKICRDCFMDAVKTGGMCPGCKEPYR
NTDLADFADNNKQQRPMLPPPAGGSKMDRRLSLMKSTKSGLMRSQTGDFDHNRWLFETSG
TYGFGNAFWTKDGNFGSDKDGNGHGMGPQDLMSRPWRPLTRKLQIPAAVISPYRLLILIR
IVVLALFLMWRIKHKNPDAIWLWGMSVVCELWFALSWLLDQLPKLCPINRATDLNVLKEK
FETPTPSNPTGKSDLPGLDMFVSTADPEKEPPLVTSNTILSILAADYPVEKLACYVSDDG
GALLTFEAMAEAASFANMWVPFCRKHNIEPRNPDSYFSLKRDPYKNKVKADFVKDRRRVK
REYDEFKVRINSLPDSIRRRSDAYHAREEIKAMKLQRQNRDEEIVEPVKIPKATWMADGT
HWPGTWINSGPDHSRSDHAGIIQVMLKPPSDEPLHGVSEGFLDLTDVDIRLPLLVYVSRE
KRPGYDHNKKAGAMNALVRASAIMSNGPFILNLDCDHYIYNSQALREGMCFMMDRGGDRL
CYVQFPQRFEGIDPSDRYANHNTVFFDVNMRALDGLMGPVYVGTGCLFRRIALYGFDPPR
AKEHHPGFCSCCFSRKKKKSRVPEENRSLRMGGDSDDDEEMNLSLVPKKFGNSTFLIDSI
PVAEFQGRPLADHPAVQNGRPPGALTIPRELLDASTVAEAIAVISCWYEDKTEWGSRIGW
IYGSVTEDVVTGYRMHNRGWKSVYCVTKRDAFRGTAPINLTDRLHQVLRWATGSVEIFFS
RNNAFFASPRMKILQRIAYLNVGIYPFTSFFLIVYCFLPALSLFSGQFIVQTLNVTFLVY
LLIISITLCLLALLEIKWSGISLEEWWRNEQFWLIGGTSAHLAAVIQGLLKVVAGIEISF
TLTSKSGGEDVDDEFADLYIVKWTSLMIPPITIMMVNLIAIAVGFSRTIYSVIPQWSKLI
GGVFFSFWVLAHLYPFAKGLMGRRGRTPTIVYVWSGLVAITISLLWVAINPPAGSTQIGG
SFTFP

MASNKHFDKSRSNLSNNSDIQEPGRPPAGHSVKFAQRTSSGRYINYSRDDLDSELGGQDF
MSYTVHIPPTPDNQPMDPSISQKVEEQYVANSMFTGGFKSNTRAHLMHKVIETEPNHPQM
AGSKGSSCAIPGCDAKVMSDERGQDLLPCECDFKICRDCFIDAVKTGGGICPGCKEPYKN
THLTDQVDENGQQRPMLPGGGGSKMERRLSMVKSTNKSALMRSQTGDFDHNRWLFETTGT
YGYGNAFWTKDGDFGSGKDGDGDGDGMGMEAQDLMSRPWRPLTRKLKIPAGVISPYRLLI
FIRIVVLALFLTWRVKHQNPDAVWLWGMSVVCELWFALSWLLDQLPKLCPINRATDLQVL
KEKFETPTASNPTGKSDLPGFDVFVSTADPEKEPPLVTANTILSILAAEYPVEKLSCYVS
DDGGALLTFEAMAEAASFANIWVPFCRKHAIEPRNPDSYFSLKRDPYKNKVKSDFVKDRR
RVKREFDEFKVRVNSLPDSIRRRSDAYHAREEIKAMKMQRQNRDDEPMEPVKIPKATWMA
DGTHWPGTWLTSASDHAKGDHAGIIQVMLKPPSDEPLHGVSEGFLDLTDVDIRLPLLVYV
SREKRPGYDHNKKAGAMNALVRASAIMSNGPFILNLDCDHYIYNSEALREGMCFMMDRGG
DRLCYVQFPQRFEGIDPSDRYANHNTVFFDVNMRALDGLMGPVYVGTGCLFRRIALYGFN
PPRSKDFSPSCWSCCFPRSKKKNIPEENRALRMSDYDDEEMNLSLVPKKFGNSTFLIDSI
PVAEFQGRPLADHPAVKNGRPPGALTIPRELLDASTVAEAIAVISCWYEDKTEWGSRIGW
IYGSVTEDVVTGYRMHNRGWKSVYCVTKRDAFRGTAPINLTDRLHQVLRWATGSVEIFFS
RNNALLASSKMKILQRIAYLNVGIYPFTSIFLIVYCFLPALSLFSGQFIVQTLNVTFLVY
LLIISITLCLLALLEIKWSGISLEEWWRNEQFWLIGGTSAHLAAVLQGLLKVVAGVEISF
TLTSKSGGDDIDDEFADLYMVKWTSLMIPPITIIMVNLIAIAVGFSRTIYSVVPQWSKLI
GGVFFSFWVLAHLYPFAKGLMGRRGRTPTIVYVWSGLVAITISLLWVAINPPAGNTEIGG
NFSFP

www.000webhost.com

Other information
Ka divergence:0.0132506KaKs divergence:0.165633
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):3438Length 2 (bp):3438Length divergence:0
MFE 1 (kcal):-1138.72MFE 2 (kcal):-1127.48MFE divergence-0.005