Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03060-AT5G16930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):AAA-type ATPase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.58052757371696
Log2 mRNA fold difference:-0.71409973812459
Log2 TE fold difference:0.16491173379191
Sequences
Protein sequence

MAQKCAIGLISALAASASLAKSKVASADGPFNLSGFSTSANPQQQASPPPPSLAGEESSA
PPRARNDNPRTSSGGFDPEALERGAKALKEINHSSYAKKVFESIKQQEETKQTEFATKAQ
EFKAMQAQAETERHKVIYDEQKKLAQHQAQTKSQMARYEDDLARKRMQAENEFHRTRNQE
LVKMQEDSAIRQEQARRATEEQIQAQRRQTEREKAEIERETIRVKAIAEAEGRAHEARLA
EDVNRRMLVDRANAEREKWVAAINTTFDHIGGGLRAILTDQNKLIVAVGGVTALAAGIYT
TREGAKVIWSYVDRILGQPSLIRESSRGKYPWSGSLSRVMSTLRGKESASKNGKRFGDVI
LHPPLAKRIEHLATSTANTKLHQAPFRNILLHGPPGTGKTMAARELARKSGLDYALMTGG
DVAPLGAQAVTKIHELFDWGKKSKRGLLLFIDEADAFLCERNKTYMSEAQRSALNALLFR
TGDQSKDIVLALATNRPGDLDSAVADRVDEVLEFPLPGEEERFKLLNLYLEKYIAEAGPS
KPGLFDRLFKKEQQKIEIKGVTEELLKEAAAKTEGFSGREIAKLMASVQAAVYGSEDCVL
DSMLFREVVDYKVAEHQQRRKLAGVDSK

MAQKIAIGVISALAASASLAPSKFAAADGPFTFSGFSTSPSASIPQQQGSTPPASESGKE
PSVAGEESDAPPRIRNNNPRTTSAGFDPEALERGAKALKGINNSAHAKKVFESIKTREET
RQAEFTAKAQEFKAMQSQAEAERQRVIYEEQKKLAQHQAQTKSQMARYEDELARKRMQAE
NEAQRTRNQELVKMQEESAIRREVARRATEEEIQAQRRQTEREKAEIERETIRVKAMAEA
EGRARESKLSEDVNRRMLVDRANAEREKWVSAINTTFDHIGGGLRTILTDQNKLIVAVGG
LTALAAGIYTTREGAKVIWSYVDRILGQPSLIRESSRGKYPWSGSASRVLSTLRGGGKES
TSKTGKGFGDVILRPALEKRIEQLANATANTKAHQAPFRNILFYGPPGTGKTMAARELAR
RSGLDYALMTGGDVAPLGAQAVTKIHQLFDWSKKSKRGLLLFIDEADAFLCERNKTYMSE
AQRSALNALLFRTGDQSKDIVLALATNRPGDLDSAVADRIDETLEFPLPGEEERFKLLNL
YLEKYISKTNLKKPGLLQSLFKKEQQTIEIKGVTEDLLKEAAAKTKGFSGREIAKLMASV
QAAVYGSANCLLDANLFREVIDYKVAEHQQRKKLAGTDAGNKKK

www.000webhost.com

Other information
Ka divergence:0.0443075KaKs divergence:-0.0405594
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1887Length 2 (bp):1935Length divergence:0.013
MFE 1 (kcal):-597.83MFE 2 (kcal):-619.44MFE divergence0.018