Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03080-AT5G17000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Zinc-binding dehydrogenase family protein
Function (paralog2):Zinc-binding dehydrogenase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.2720878909704
Log2 mRNA fold difference:3.3104631095273
Log2 TE fold difference:0.71507779574133
Sequences
Protein sequence

MATSGNATVANKQVILRDYVTGFPKESDLIFTDSTIDLKIPEGSKTVLVKNLYLSCDPYM
RIRMGKPDPGTAALAPHYIPGEPIYGFSVSKVIDSGHPDYKKGDLLWGLVGWGEYSLITP
DFSHYKIQHTDVPLSYYTGLLGMPGMTAYAGFYEICSPKKGETVFVSAASGAVGQLVGQF
AKIMGCYVVGSAGSNEKVDLLKNKFGFDDAFNYKAEPDLNAALKRCFPEGIDIYFENVGG
KMLDAVLLNMKLHGRIAVCGMISQYNLEDQEGVHNLANVIYKRIRIKGFVVSDYFDKHLK
FLDFVLPYIREGKITYVEDVVEGLENGPSALLGLFHGKNVGKQLIAVARE

MTATNKQVVLKNYVSGFPKESDFDFKTTTVEFKLPGGSNSVLVKNLYLSCDPYMRIRMGK
PDPSTAALAQAYAPGKPIFGYGVSRVIESGHPDYKKGDLLWGIVGWEEYSVITPMTHMHF
KIQHTDIPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQFAKMMG
CYVVGSAGSTEKVDLLKTKFGFDDAFNYKEEPDLSAALKRCFPTGIDIYFENVGGKMLDA
VLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNIIYKRIRIQGFAVFDFYEKYSKFLDFV
LPHIKEGKITYVEDVADGLEKGPEALVGLFHGKNVGKQVVVIARE

www.000webhost.com

Other information
Ka divergence:-0.0141906KaKs divergence:-0.11055
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1053Length 2 (bp):1038Length divergence:-0.007
MFE 1 (kcal):-332.13MFE 2 (kcal):-332.19MFE divergence0