Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03090-AT5G17010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vacuolar glucose transporter 1
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.64478329135079
Log2 mRNA fold difference:0.065628548022665
Log2 TE fold difference:0.58647448348099
Sequences
Protein sequence

MGFDPENQSISSVGQVVGDSSSGGITAEKEPLLKENHSPENYSVLAAIPPFLFPALGALL
FGYEIGATSCAIMSLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGR
RKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAPSQIRGR
MISLKEFSTVLGMVGGYGIGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLL
RALQGQGNGENLQQAAIRSLCRLRGSVIADSAAEQVNEILAELSLVGEDKEATFGELFRG
KCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLGLLKLVMTGV
SVIVIDRVGRRPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVGCYQLSFGPI
GWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVVSL
FFIYYIVPETKGLTLEEIEAKCL

MALDPEQQQPISSVSREFGKSSGEISPEREPLIKENHVPENYSVVAAILPFLFPALGGLL
YGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGR
RKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAPSPIRGQ
LVSLKEFFIVLGMVGGYGIGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLL
RVIQGKGNVENQREAAIKSLCCLRGPAFVDSAAEQVNEILAELTFVGEDKEVTFGELFQG
KCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGLLKLIMTGV
AVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPI
GWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGFGVICVLSL
VFIFFIVPETKGLTLEEIEAKCL

www.000webhost.com

Other information
Ka divergence:-0.472012KaKs divergence:-0.386148
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1512Length 2 (bp):1512Length divergence:0
MFE 1 (kcal):-488.69MFE 2 (kcal):-509.16MFE divergence0.021