Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03110-AT5G17020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):exportin 1B
Function (paralog2):exportin 1A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6921665561514
Log2 mRNA fold difference:1.9677245187721
Log2 TE fold difference:-0.446938397096
Sequences
Protein sequence

MAAEKLRDLSQPIDVVLLDATVEAFYSTGSKEERASADNILRDLKANPDTWLQVVHILQN
TSSTHTKFFALQVLEGVIKYRWNALPVEQRDGMKNYISDVIVQLSRDEASFRTERLYVNK
LNIILVQIVKQEWPAKWKSFIPDLVIAAKTSETICENCMAILKLLSEEVFDFSKGEMTQQ
KIKELKQSLNSEFQLIHELCLYVLSASQRQELIRATLSALHAYLSWIPLGYIFESPLLEI
LLKFFPVPAYRNLTLQCLSEVASLNFGDFYDMQYVKMYSIFMNQLQAILPLNLNIPEAYS
TGSSEEQAFIQNLALFFTSFFKLHIKILESAPENISLLLAGLGYLISISYVDDTEVFKVC
LDYWNSLVLELFGTRHHACHPALTPSLFGLQMAFLPSTVDGVKSEVTERQKLYSDPMSKL
RGLMISRTAKPEEVLIVEDENGNIVRETMKDNDVLVQYKIMRETLIYLSHLDHEDTEKQM
LSKLSKQLSGEEWAWNNLNTLCWAIGSISGSMVVEQENRFLVMVIRDLLSLCEVVKGKDN
KAVIASNIMYVVGQYSRFLRAHWKFLKTVVHKLFEFMHETHPGVQDMACDTFLKIVQKCK
RKFVIVQVGESEPFVSELLSGLATIVGDLQPHQIHTFYESVGSMIQAESDPQKRGEYLQR
LMALPNQKWAEIIGQARQSADILKEPDVIRTVLNILQTNTRVATSLGTFFLSQISLIFLD
MLNVYRMYSELVSSSIANGGPYASRTSLVKLLRSVKREILKLIETFLDKAENQPHIGKQF
VPPMMDQVLGDYARNVPDARESEVLSLFATIINKYKVVMRDEVPLIFEAVFQCTLEMITK
NFEDYPEHRLKFFSLLRAIATFCFRALIQLSSEQLKLVMDSVIWAFRHTERNIAETGLNL
LLEMLKNFQKSDFCNKFYQTYFLQIEQEVFAVLTDTFHKPGFKLHVLVLQHLFSLVESGS
LAEPLWDAATVPHPYSNNVAFVLEYTTKLLSSSFPNMTTTEVTQFVNGLYESRNDVGRFK
DNIRDFLIQSKEFSAQDNKDLYAEEAAAQMERERQRMLSIPGLIAPSEIQDDMADS

MAAEKLRDLSQPIDVGVLDATVAAFFVTGSKEERAAADQILRDLQANPDMWLQVVHILQN
TNSLDTKFFALQVLEGVIKYRWNALPVEQRDGMKNYISEVIVQLSSNEASFRSERLYVNK
LNVILVQIVKHDWPAKWTSFIPDLVAAAKTSETICENCMAILKLLSEEVFDFSRGEMTQQ
KIKELKQSLNSEFKLIHELCLYVLSASQRQDLIRATLSALHAYLSWIPLGYIFESTLLET
LLKFFPVPAYRNLTIQCLTEVAALNFGDFYNVQYVKMYTIFIGQLRIILPPSTKIPEAYS
SGSGEEQAFIQNLALFFTSFFKFHIRVLESTPEVVSLLLAGLEYLINISYVDDTEVFKVC
LDYWNSLVLELFDAHHNSDNPAVSASLMGLQPFLPGMVDGLGSQVMQRRQLYSHPMSKLR
GLMINRMAKPEEVLIVEDENGNIVRETMKDNDVLVQYKIMRETLIYLSHLDHDDTEKQML
RKLNKQLSGEEWAWNNLNTLCWAIGSISGSMAEDQENRFLVMVIRDLLNLCEITKGKDNK
AVIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHPGVQDMACDTFLKIVQKCKR
KFVIVQVGENEPFVSELLTGLATTVQDLEPHQIHSFYESVGNMIQAESDPQKRDEYLQRL
MALPNQKWAEIIGQARHSVEFLKDQVVIRTVLNILQTNTSAATSLGTYFLSQISLIFLDM
LNVYRMYSELVSTNITEGGPYASKTSFVKLLRSVKRETLKLIETFLDKAEDQPHIGKQFV
PPMMESVLGDYARNVPDARESEVLSLFATIINKYKATMLDDVPHIFEAVFQCTLEMITKN
FEDYPEHRLKFFSLLRAIATFCFPALIKLSSPQLKLVMDSIIWAFRHTERNIAETGLNLL
LEMLKNFQQSEFCNQFYRSYFMQIEQEIFAVLTDTFHKPGFKLHVLVLQQLFCLPESGAL
TEPLWDATTVPYPYPDNVAFVREYTIKLLSSSFPNMTAAEVTQFVNGLYESRNDPSGFKN
NIRDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMVDS

Other information
Ka divergence:-0.364324KaKs divergence:-0.0310506
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):3231Length 2 (bp):3228Length divergence:0
MFE 1 (kcal):-935.01MFE 2 (kcal):-919.31MFE divergence-0.008