Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03120-AT5G17060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ADP-ribosylation factor B1C
Function (paralog2):ADP-ribosylation factor B1B

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.69744211532386
Log2 mRNA fold difference:-0.28303924489406
Log2 TE fold difference:-0.56614161426296
Sequences
Protein sequence

MGQTFRKLFDTFFGNQEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKN
VIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQDIIRDPFMLNSV
ILVFANKQDMRGAMSPREVCEGLGLLDLKNRKWHIQGTCALQGDGLYEGLDWLSATLKEV
KAAGYSSVGPSF

MGQAFRKLFDTFFGNQEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKN
VMFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQEIIKDPFMLNSI
ILVFANKQDMRGAMSPREVCEGLGLFDLKNRKWHIQGTCALRGDGLYEGLDWLSSTLKDV
KAAGFTSVGHSF

www.000webhost.com

Other information
Ka divergence:-0.223925KaKs divergence:0.0521141
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):579Length 2 (bp):579Length divergence:0
MFE 1 (kcal):-168.3MFE 2 (kcal):-156.9MFE divergence-0.035