Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03160-AT5G17190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.91813926534291
Log2 mRNA fold difference:0.22533388912124
Log2 TE fold difference:0.70644638087466
Sequences
Protein sequence

MALEWVVLGYAAAAEAIMVVLLTMPGLDGLRKGLVAVTRNLLKPFLSIVPFCLFLLMDIY
WKYETMPSCDGDSCTPSEHLRHQKSMMKSQRNALLIAAALVFYWILYSVTNLVVKIEHLN
QRIERLRNKD

MALEWVVLGYAAAAEAIMVILLTMPGLDALRKGLVAVTRNLLKPFLSIIPFCLFLLMDIY
WKYETRPSCDGDSCTPSEHLRHQKSIMKSQRNALLIASALVFYWILYSVTNLVVRIEQLN
QRVERLKNKD

www.000webhost.com

Other information
Ka divergence:-0.0683636KaKs divergence:-0.597015
GC content 1 (%):50GC content 2 (%):45GC content divergence:-0.053
Length 1 (bp):393Length 2 (bp):393Length divergence:0
MFE 1 (kcal):-119.5MFE 2 (kcal):-113.5MFE divergence-0.026