Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03190-AT5G17220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutathione S-transferase F11
Function (paralog2):glutathione S-transferase phi 12

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.3634113615769
Log2 mRNA fold difference:-2.1272262293976
Log2 TE fold difference:1.7147060618723
Sequences
Protein sequence

MVVKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDG
YLKLFESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVF
KPKSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNET
SLSGLVTSRENLNRWWNEISARPAWKKLMELAAY

MVVKLYGQVTAACPQRVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDG
DFKLFESRAIARYYATKFADQGTNLLGKSLEHRAIVDQWADVETYYFNVLAQPLVINLII
KPRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLAGEEFTMADLTHMPAMGYLMSIT
DINQMVKARGSFNRWWEEISDRPSWKKLMVLAGH

www.000webhost.com

Other information
Ka divergence:0.0344777KaKs divergence:0.260534
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):645Length 2 (bp):645Length divergence:0
MFE 1 (kcal):-203.71MFE 2 (kcal):-196.94MFE divergence-0.017