Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03200-AT5G17260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAC domain containing protein 45
Function (paralog2):NAC domain containing protein 86

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.0069598340602281
Log2 mRNA fold difference:-0.35448573756429
Log2 TE fold difference:0.42675230544765
Sequences
Protein sequence

MAPVSLPPGFRFHPTDEELITYYLKRKINGLEIELEVIAEVDLYKCEPWDLPGKSLLPSK
DQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSWRDRAIGTKKTLVYYRGRAPH
GIRTGWVMHEYRLDETECEPSAYGMQDAYALCRVFKKIVIEAKPRDQHRSYVHAMSNVSG
NCSSSFDTCSDLEISSTTHQVQNTFQPRFGNERFNSNAISNEDWSQYYGSSYRPFPTPYK
VNTEIECSMLQHNIYLPPLRVENSAFSDSDFFTSMTHNNDHGVFDDFTFAASNSNHNNSV
GDQVIHVGNYDEQLITSNRHMNQTGYIKEQKIRSSLDNTDEDPGFHGNNTNDNIDIDDFL
SFDIYNEDNVNQIEDNEDVNTNETLDSSGFEVVEEETRFNNQMLISTYQTTKILYHQVVP
CHTLKVHVNPISHNVEERTLFIEEDKDSWLQRAEKITKTKLTLFSLMAQQYYKCLAIFF

MAPVSLPPGFRFHPTDEELITYYLKRKINGQEIELEIIPEVDLYKCEPWDLPGKSLIPSK
DQEWFFFSPRDRKYPNGSRTNRATKGGYWKATGKDRRVSWRDRAIGTKKTLVYYRGRAPH
GIRTGWVMHEYRLDESECEPSAFGMQDAYALCRVFKKIVIEAKPRDQHQQQHQPYVHTSS
NISGSSSFDVCSDLEISSNTPYNTAAHIQPRFGNANAISDHDDWSQYLSQNMPTSFSDYG
SPYGPYLTQSKVNTEVQCEMFQHQMSLPPLRVENSQAQTSDFSKRLHQNSGQSGFDDFTF
AASNSNQFYNSNVDDHLIHIGNLDEQSYIEEQELILPSFQSNDQDLELYGGSRTNTIDNI
EIDDFFSFENQAQDNDNSNVTPNSAGFEMIGEEIIVNHKMLISTRQTTEILYYQVVPSQI
LKIHINPVHGNEERTMLMEEDSDDSWFQKAENVAKMKLKQISLVAKRYYKCLTIIF

www.000webhost.com

Other information
Ka divergence:0.167243KaKs divergence:-0.0526946
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1440Length 2 (bp):1431Length divergence:-0.003
MFE 1 (kcal):-386.27MFE 2 (kcal):-388.87MFE divergence0.003