Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03250-AT5G17310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-GLUCOSE PYROPHOSPHORYLASE 1
Function (paralog2):UDP-glucose pyrophosphorylase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0581947411449
Log2 mRNA fold difference:-0.61704781801667
Log2 TE fold difference:-0.45104699190589
Sequences
Protein sequence

MAATTENLPQLKSAVDGLTEMSESEKSGFISLVSRYLSGEAQHIEWSKIQTPTDEIVVPY
EKMTPVSQDVAETKNLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIEN
LNNKYGCKVPLVLMNSFNTHDDTHKIVEKYTNSNVDIHTFNQSKYPRVVADEFVPWPSKG
KTDKEGWYPPGHGDVFPALMNSGKLDTFLSQGKEYVFVANSDNLGAIVDLTILKHLIQNK
NEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWVN
LKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPVK
ASSDLLLVQSDLYTLVDGFVTRNKARTNPSNPSIELGPEFKKVATFLSRFKSIPSIVELD
SLKVSGDVWFGSSIVLKGKVTVAAKSGVKLEIPDRAVVENKNINGPEDL

MAATATEKLPQLKSAVDGLTEMSENEKSGFINLVSRYLSGEAQHIEWSKIQTPTDEIVVP
YDKMANVSEDASETKYLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRDGLTFLDLIVIQIE
NLNNKYNCKVPLVLMNSFNTHDDTQKIVEKYTKSNVDIHTFNQSKYPRVVADEFVPWPSK
GKTDKDGWYPPGHGDVFPSLMNSGKLDAFLSQGKEYVFIANSDNLGAIVDLKILKHLIQN
KNEYCMEVTPKTLADVKGGTLISYEGKVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWV
NLKAIKKLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDNAIGVNVPRSRFLPV
KATSDLLLVQSDLYTLVDGFVTRNKARTNPTNPAIELGPEFKKVASFLSRFKSIPSIVEL
DSLKVSGDVWFGSGVVLKGKVTVKANAGTKLEIPDNAVLENKDINGPEDL

Other information
Ka divergence:0.2254KaKs divergence:0.0666667
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1410Length 2 (bp):1413Length divergence:0.001
MFE 1 (kcal):-457.73MFE 2 (kcal):-414.82MFE divergence-0.049