Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03280-AT5G17350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.12322879778383
Log2 mRNA fold difference:-0.58964978050063
Log2 TE fold difference:0.24153072216307
Sequences
Protein sequence

MGNYVSCALNKTSSSPLAKVILPDGGVRDIHVPTKAAELMMEMPSYFLVDTKSVKVGRKF
IPLAADDDLDLGGCHVYVAFPMTRATSAANASDMARLYLTGKKRTKNCGHRRVSPENEDN
DDVRLIGPKLNLEDIEEFSAAEFIHRISVSKSKKPQLETIAEDHVP

MGNYVSSALSKTSSSSSSAAKVILPDGGVRNIHAPMKAAELMMEIPSFFLVDAKSLKIGR
KFCPLAADDDLQIKGCHVYVAFPMTRATSAANASDLARLFVAAKKQRRHRVGSDHSSAAV
KHCHNNGRVSPDGEGDDVKVISAGSKLNLEDIEEFSAAEFMHRISVSKSKKPKLETIVEE
SLS

www.000webhost.com

Other information
Ka divergence:0.19222KaKs divergence:-0.999873
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):501Length 2 (bp):552Length divergence:0.048
MFE 1 (kcal):-159.37MFE 2 (kcal):-180.9MFE divergence0.063