Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03290-AT5G17390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Adenine nucleotide alpha hydrolases-like superfamily protein
Function (paralog2):Adenine nucleotide alpha hydrolases-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:4.3274903949618
Log2 mRNA fold difference:3.4852775404538
Log2 TE fold difference:0.81187290195693
Sequences
Protein sequence

MARSLKKSVKLSLRHVRIRSSTIGFKPDSSSIEIDQRIEFLGEEETDGDSTSEYEEFEEE
KERGGEGEGEEQDDGCKIVESGYKSEHEETEAAVEAVEAEITEAGNRVMVVVDKVIASTG
ALEWALKHTLQSQDYLFLLYFSKPFRKGKRKNRKSEVKTDELVHTLKKLCQTKRPGIEVE
IRRLQGKEKEKGEKIVEEAKEQQVSLLVVGKEKKPPVWRLLKRWGWKKRRGRAGTLKYCL
EKASCMTIAVKPKNRKLGGYLITTKRHKNFWLLA

MARSLKKSAKLSLRRVRINSPSIRFKPDSSSIERDQRIEFLGENGDDAGSGEEDTKEANN
ESEEVEDKEEERVKVIVEEEEEKEQDDAKSFNIGGGEGKKEAVAAVEAVEEEAEGGNRVM
VVVDKALASTGALEWAITHTLQPQDTLFLLYFAKPFRKSKRKNRKREVKTDELVHTLKKL
CQTKRPGIEVEIRRLEGKDKDKGQKIVEESKKQQVSLLVVGQEKKPPVWRLLKRWAWKRR
RGHEGVLKYCLENASCMTIAVKPKNRKLGGYLITTKRHKNFWLLA

www.000webhost.com

Other information
Ka divergence:-0.39333KaKs divergence:-0.665909
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):825Length 2 (bp):858Length divergence:0.02
MFE 1 (kcal):-215.22MFE 2 (kcal):-232.26MFE divergence0.038