Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03310-AT3G03370
Species:Arabidopsis
Duplication type:TD
Function (paralog1):lecithin:cholesterol acyltransferase 3
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.9900075608338
Log2 mRNA fold difference:-2.007210760788
Log2 TE fold difference:-0.042169515699609
Sequences
Protein sequence

MGWIPCPCWGTNDDENAGEVADRDPVLLVSGIGGSILHSKKKNSKSEIRVWVRIFLANLA
FKQSLWSLYNPKTGYTEPLDDNIEVLVPDDDHGLYAIDILDPSWFVKLCHLTEVYHFHDM
IEMLVGCGYKKGTTLFGYGYDFRQSNRIDLLILGLKKKLETAYKRSGGRKVTIISHSMGG
LMVSCFMYLHPEAFSKYVNKWITIATPFQGAPGCINDSILTGVQFVEGLESFFFVSRWTM
HQLLVECPSIYEMMANPDFKWKKQPEIRVWRKKSENDVDTSVELESFGLIESIDLFNDAL
KNNELSYGGNKIALPFNFAILDWAAKTREILNKAQLPDGVSFYNIYGVSLNTPFDVCYGT
ETSPIDDLSEICQTMPEYTYVDGDGTVPAESAAAAQFKAVASVGVSGSHRGLLRDERVFE
LIQQWLGVEPKKAKRKHLRTHKVVDSG

MVDEDHLEDFVCYTEPLDDNIEVLVPDDDHGLYAIDILDPSWKVANEDISGLGDLVSVLS
KLSRGARVPLEYMSHTDRHRKKHLNNLPFRFKKNRDFDFFSHLFLRDRLGGAFHENIASL
AAWSVSSMLRTLMDSTYKFVVAQLHTFSSLSLDSFCGISPERLLCERSTFSRFPKLCGIN
PEMSLYERPCFEFFQFTAKLCITIVKLYMKRKSEDELTRDSFMPVSQEMKGEIHQDCSQR
DPRP

www.000webhost.com

Other information
Ka divergence:0.782384KaKs divergence:-0.872621
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1344Length 2 (bp):735Length divergence:-0.293
MFE 1 (kcal):-403.1MFE 2 (kcal):-210.7MFE divergence-0.313