Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03330-AT3G03350
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NAD(P)-binding Rossmann-fold superfamily protein
Function (paralog2):NAD(P)-binding Rossmann-fold superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.6904066901694
Log2 mRNA fold difference:-3.5381783739981
Log2 TE fold difference:0.7971517619026
Sequences
Protein sequence

MLTLLFFSLGALLLIVLLFKFAFADGDFTLISKKHVKREAIQGKVVWITGASRGIGEILA
KQFASLDAKLILSARNKAELDRVKSELKGKFAPEDVKVLPLDLASGEESLKHVVEQAVSL
FPGAGVDYLVHNAAFERPKSKASDASEETLKTTFDVNVFGTISLTKLVAPHMLKQGGGHF
VVISSAAGKVPSPGQAIYSASKHALHGYFHSLRSEFCQKGIKVTVVCPGPIETWNGTGTS
TSEDSKSPEKRVSSERCAELTIIAASHNLKEAWISYQPVLLVMYLVQYMPSLGFWLMDKV
GGKRVEVAEKKGNTYSWDLLFGKKTKTN

MFLVLHYLTNQTNSDSYLGGHTGITTPLRPPPPRKTYCSKSSSSPPPPKYMYVTGVPGEL
YRTEPDDQWGYNSSVNRNLVKCLLVIVIVGFGVINFPTLISEKLSVELKLKLDFPLGLPG
IEIRIEFSVKFTWDQRNKLTQEVSSAFSGKLNILNNLRTILPHFYQLRLPAPEEIASLVA
FLCLPAASYTTRQEELKACLNDCKSSGLVVSGSVRDQRDKLIQWQAQHSFLCRFIIIFFF
LQKSKASDASEETINTTFDINVFGTITLIKLVTPHMLKQGGGHFVVISSAAGKVPSPGQA
IYSASKHALHGYFHSLRSEFCQEGIKVTVVIPGPIETLNGTGTSTSEDKKSHEKRVSSE

www.000webhost.com

Other information
Ka divergence:0.816622KaKs divergence:0.570909
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):987Length 2 (bp):1080Length divergence:0.045
MFE 1 (kcal):-302.12MFE 2 (kcal):-297.9MFE divergence-0.007