Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03340-AT5G17440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LUC7 related protein
Function (paralog2):LUC7 related protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.84853643920978
Log2 mRNA fold difference:0.53138257607668
Log2 TE fold difference:-1.0866838881411
Sequences
Protein sequence

MDAIRKQLDVLMGANRNGDVQEVNRKYYDRDVCRLYLSGLCPHDLFQLTKMDMGPCPKVH
SLQLRKEYREARAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLQEEDAKAAIAISVSE
VTQSPEILELSEKIKEKMKEADIHDLEGKMDLKIRALELVEEMRTKRADQQAVLLLEAFN
KDRASLPQPVPAQPPSSELPPPDPRTQEMINEKLKKAEDLGEQGMVDEAQKALEEAEALK
KLTVRREPPADSTKYTAVDVRITDQKLRLCDICGAFLSVYDSDRRLADHFGGKLHLGYML
VRDKLTELLDEKANIRKERSKERNSKERESSKDREKEQETSREHRRDYDRRSRDRDRHHD
RDREQDRDYDRSHSRSRRRSRSRSRSRDRPRDYDRHRRHNRY

MDAMRKQLDVLMGANRNGDVTEVNRKYYDRDVCRLYLSGLCPHELFQLTKMDMGPCPKVH
SLQLRKEYKDAKAKGVDNYDRELEDAIDRLIVECDRKIGRALNRLQEEDAKAAIAISVTE
FTQSPEILELSKQIKEKMKEADLHDLEGKTDLKIRALELVEEMRTKRADLQAVLLLDAFN
KDRTSLQQAVPAQQPAATLPPPDPRTQEMINEKLKKAEELGEQGMVDEAQKALEEAEALK
KLTARQEPVVDSTKYTAADVRITDQKLRLCDICGAFLSVYDSDRRLADHFGGKLHLGYML
IRDKLAELQEEKNKVHKERVEERRSKERSRERESSKDRDGGDNRDRGRDVDRRSRDRDRH
HDHREHDRNYNQSRGYDSRSRRSSRSRSRERPRDHDRRRRHDRY

Other information
Ka divergence:-0.254386KaKs divergence:-0.077194
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1209Length 2 (bp):1215Length divergence:0.002
MFE 1 (kcal):-374.8MFE 2 (kcal):-371.4MFE divergence-0.005