Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03450-AT5G17490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RGA-like 2
Function (paralog2):RGA-like protein 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.72032035855334
Log2 mRNA fold difference:-1.2697302260699
Log2 TE fold difference:0.71628602655936
Sequences
Protein sequence

MKRGYGETWDPPPKPLPASRSGEGPSMADKKKADDDNNNSNMDDELLAVLGYKVRSSEMA
EVAQKLEQLEMVLSNDDVGSTVLNDSVHYNPSDLSNWVESMLSELNNPASSDLDTTRSCV
DRSEYDLRAIPGLSAFPKEEEVFDEEASSKRIRLGSWCESSDESTRSVVLVDSQETGVRL
VHALVACAEAIHQENLNLADALVKRVGTLAGSQAGAMGKVATYFAQALARRIYRDYTAET
DVCAAVNPSFEEVLEMHFYESCPYLKFAHFTANQAILEAVTTARRVHVIDLGLNQGMQWP
ALMQALALRPGGPPSFRLTGIGPPQTENSDSLQQLGWKLAQFAQNMGVEFEFKGLAAESL
SDLEPEMFETRPESETLVVNSVFELHRLLARSGSIEKLLNTVKAIKPSIVTVVEQEANHN
GIVFLDRFNEALHYYSSLFDSLEDSYSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHE
TAAQWRIRMKSAGFDPIHLGSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRPLIT
TSAWKLA

MKRSHQETSVEEEAPSMVEKLENGCGGGGDDNMDEFLAVLGYKVRSSDMADVAQKLEQLE
MVLSNDIASSSNAFNDTVHYNPSDLSGWAQSMLSDLNYYPDLDPNRICDLRPITDDDECC
SSNSNSNKRIRLGPWCDSVTSESTRSVVLIEETGVRLVQALVACAEAVQLENLSLADALV
KRVGLLAASQAGAMGKVATYFAEALARRIYRIHPSAAAIDPSFEEILQMNFYDSCPYLKF
AHFTANQAILEAVTTSRVVHVIDLGLNQGMQWPALMQALALRPGGPPSFRLTGVGNPSNR
EGIQELGWKLAQLAQAIGVEFKFNGLTTERLSDLEPDMFETRTESETLVVNSVFELHPVL
SQPGSIEKLLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLEDGVVIP
SQDRVMSEVYLGRQILNLVATEGSDRIERHETLAQWRKRMGSAGFDPVNLGSDAFKQASL
LLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAAELRR

www.000webhost.com

Other information
Ka divergence:0.204615KaKs divergence:-0.855034
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):1644Length 2 (bp):1572Length divergence:-0.022
MFE 1 (kcal):-576.9MFE 2 (kcal):-584.31MFE divergence0.006