Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03460-AT5G17510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.1652636223902
Log2 mRNA fold difference:1.1941876223887
Log2 TE fold difference:-0.068569484989307
Sequences
Protein sequence

MEESKQQQLQQQQLLLQMQQQQQMQQRQQQLFLMQHLQKQQQQQAAMSMFPPNADAHLRP
PGLIPNRPVNPFLQNVNPNPNLIQQANKFQQQQQQQMMMMMQQQQLQQQQQQKLMRPSNQ
LEIQFAYQDAWRVCHPDFKRPFASLEDACERLLPYHVVADYEAEEDDSIFDSNTTSQTLP
RCQQWDNNIAAKVAEFTATFEGQVQAFDRIIQKRSDGDRVEERLMMEQVLLNDERNACIQ
LDREMKAQDARLRMAALAQAAGQARAEESQQSHAEMMARNPLRANAIGNHGEQGRNMNPN
EMMLLMNGWGNNNNNNNSQKEEKEPLEDFLNDEENENGEHEKWRRSGDFDLNIR

MEDTKPPLGGNNNPQQQQQQQQLLYQHQLQQQQRQQQMLLLQQLQKQQQQQAAMSRFPSN
IDVHLRPPGLIQNRPINPPPQQNPTPNPNLGQQTPNFQQQQQQNVSSQQMMQQQQQQQQQ
QKLMRPLNHIELQCAYQDAWRVCHPNFKQPFSSLEDACERLLPYHVVADYEAEEDDRILD
SDPTGQALSRSQQWDNNIAAKVAEFTATFEKQALAFNIITRKRAMGEFRSEERLMVEQAL
LQDERKALIELKAEMDREKAGREAQEAKLRMAALAQAGQSQSHAEIMARNPLRANAVGNQ
GSNIQLSHEMGEQGRNMNPDEMMNGWGNNSQREDKEPSEDFLNDEENENGETGEQENWRE
AGEFDLNSR

www.000webhost.com

Other information
Ka divergence:-0.256648KaKs divergence:0.999705
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1065Length 2 (bp):1110Length divergence:0.021
MFE 1 (kcal):-287.01MFE 2 (kcal):-317.84MFE divergence0.051