Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03480-AT5G17540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase
Function (paralog2):HXXXD-type acyl-transferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.4894240468757
Log2 mRNA fold difference:1.9914986216029
Log2 TE fold difference:-3.1044629234906
Sequences
Protein sequence

MDHQVSLPQSTTTGLSFKVHRQQRELVTPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYR
PNLSSDLDPVQVIKKALADALVYYYPFAGRLRELSNRKLAVDCTGEGVLFIEAEADVALA
ELEEADALLPPFPFLEELLFDVEGSSDVLNTPLLLVQVTRLKCCGFIFALRFNHTMTDGA
GLSLFLKSLCELACGLHAPSVPPVWNRHLLTVSASEARVTHTHREYDDQVGIDVVATGHP
LVSRSFFFRAEEISAIRKLLPPDLHNTSFEALSSFLWRCRTIALNPDPNTEMRLTCIINS
RSKLRNPPLEPGYYGNVFVIPAAIATARDLIEKPLEFALRLIQETKSSVTEDYVRSVTAL
MATRGRPMFVASGNYIISDLRHFDLGKIDFGPWGKPVYGGTAKAGIALFPGVSFYVPFKN
KKGETGTVVAISLPVRAMETFVAELNGVLNVSKG

MSGSLTFKIYRQKPELVSPAKPTPRELKPLSDIDDQEGLRFHIPTIFFYRHNPTTNSDPV
AVIRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEADADVTLVEFEEKDALKP
PFPCFEELLFNVEGSCEMLNTPLMLMQVTRLKCGGFIFAVRINHAMSDAGGLTLFLKTMC
EFVRGYHAPTVAPVWERHLLSARVLLRVTHAHREYDEMPAIGTELGSRRDNLVGRSLFFG
PCEMSAIRRLLPPNLVNSSTNMEMLTSFLWRYRTIALRPDQDKEMRLILIVNARSKLKNP
PLPRGYYGNAFAFPVAIATANELTKKPLEFALRLIKEAKSSVTEEYMRSLADLMVIKGRP
SFSSDGAYLVSDVRIFADIDFGIWGKPVYGGIGTAGVEDLPGASFYVSFEKRNGEIGIVV
PVCLPEKAMQRFVEELEGVFNGQVVFNRGSKSSNKLIMSSL

www.000webhost.com

Other information
Ka divergence:-0.183586KaKs divergence:0.153093
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):1365Length 2 (bp):1386Length divergence:0.008
MFE 1 (kcal):-459.15MFE 2 (kcal):-445.25MFE divergence-0.015