Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03490-AT5G17550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):peroxin 19-1
Function (paralog2):peroxin 19-2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.57657267712252
Log2 mRNA fold difference:1.1646988494076
Log2 TE fold difference:-1.7381177136507
Sequences
Protein sequence

MANSHTDDLDELLDSALDDFKDLNLSHQRNQREAQEEEEKKRKEETVLLPSGVQGLGMGL
PDMRSKKRGKQKVSKEDHVAEALDKLREQTRETVKGLESISSKQLPASDDDGMVEDFLKQ
FEDLAGSKDLESIVETMMQQLLSKDILHEPMKELGARYPKWLKENEASLSKEDYKRYSQQ
YKLIEELNAVYENEPNNSSKIMEIMQKMQECGQPPSDIVKEIDPGFDFASLGQISPEMLE
SSPNCCIM

MANDTHTDDLDELLDSALDDFKDLNLTQRNGGVKKEEGDKKETESLPSGVQGLGMGLPDM
RSKKKGKKKIAKEDHVTEALDKLREQTRETVKGLESLSSKQQPTGSDDAMVEDWIKQFEN
LTGSNDLESIVDTMMQQLLSKDILHEPMKEIGARYPKWLEEHESSLNKEEFDRYSRQYEL
IKELNLVYENEPNNSTKIMEIMQKMQECGQPPSDIVQEMDPGFDFASLGQMSPDMLESSP
NCCVM

www.000webhost.com

Other information
Ka divergence:-0.212261KaKs divergence:0.195091
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):747Length 2 (bp):738Length divergence:-0.006
MFE 1 (kcal):-195.95MFE 2 (kcal):-195.91MFE divergence0