Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03500-AT5G17570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TatD related DNase
Function (paralog2):TatD related DNase

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.75127650230427
Log2 mRNA fold difference:0.40379146765285
Log2 TE fold difference:-1.0281434937754
Sequences
Protein sequence

MKLFDAHCHLQDKRVIDKASQLISAALAVGVTNFAVNGTSEKDWNLVKEMGETYPSVVPC
FGLHPWFIADRSPHWFKTLKKFFETTPTAAVGEIGLDKGPLAGGIDYSDQLVVFRPQLEL
AKELNKPVAVHCIDAFDDLLEIMRSIGPFPAGVILHSFNGSAEVVPKLAELGAYFSFSGW
FTYIDEKIAKKTLKSIPSDRLLLETDSPDGLPKSDESSSDPKPTLNEPANILAVLDYVAN
LSNMKKEELAELSYVNSVRLFSYPGSKLLTDQ

MKLFDAHCHLQDPRIITKAPQIISSAVASGVSAFAVNGVSEKDWSLVKEMGAKYPSVVPC
FGIHPWYVAERSPQWFETLKSFFETTPTAAVGEIGLDKGSKGREIDFSEQVTVFRQQLEL
AKELKKPASVHCVRAFGDLLEILKSVGPFPSGVMLHSYLGSAEMVPEFAKLGAYFSFSGF
LMSMSEKKAKKMLKAVPSDRILLETDSPDALPKAESGCLYFVDGDPSLPEEGNSAQDLDS
ASYDKPNVSSDSMKLTKETLNHPANIHIVLGYVAQLLDMKNEELAELSYQNAVRLFSYEG
SKILLDRGTGDVSGHTQNQSTTHVS

Other information
Ka divergence:-0.579627KaKs divergence:-0.0281104
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):819Length 2 (bp):978Length divergence:0.088
MFE 1 (kcal):-241.38MFE 2 (kcal):-290.43MFE divergence0.092