Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03550-AT5G17600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.2601701433369
Log2 mRNA fold difference:-0.39970251833629
Log2 TE fold difference:-0.91125922216229
Sequences
Protein sequence

MGSTGNPNPWGTTYDSYRDCSQGVCSVYCPQWCYVIFPPPPSFYLDDEDDSSSSDFSPLL
IALIGILASAFILVSYYTLISKYCHRRRHNSSSTSAAAINRISSDYTWQGTNNNNNNGAT
NPNQTIGGGGGDGLDESLIKSITVYKYRKMDGFVESSDCSVCLSEFQENESLRLLPKCNH
AFHVPCIDTWLKSHSNCPLCRAFIVTSSAVEIVDLTNQQIVTENNSISTGDDSVVVVNLD
LENSRSRNETVNEGSTPKPPEMQDSRDGEERRSASLNSGGGVVSIADILREIEDDEESAG
VGTSRWVEEGEGEKTPPPSGSAANQTNGISNFLVRSSMAAMKRSGYDRAKNYRLPK

MSTNPNPWSPYDSYNDCSQGICNIYCPQWCYLIFPPPPPSFFLDDDSSSSSSSFSPLLIA
LIGILTSALILVSYYTLISKYCHRHHQTSSSETLNLNHNGEGFFSSTQRISTNGDGLNES
MIKSITVYKYKSGDGFVDGSDCSVCLSEFEENESLRLLPKCNHAFHLPCIDTWLKSHSNC
PLCRAFVTGVNNPTASVGQNVSVVVANQSNSAHQTGSVSEINLNLAGYESQTGDFDSVVV
IEDLEIGSRNSDARSELQLPEERRETKDEDSLPIRRSVSLNSGVVVSIADVLREIEDEEG
ESGGVGTSQRREEGEDGDGKTIPPTEANQRSGGVSGFFVRSLSTGRFIFSRYDRGRNYRL
PL

www.000webhost.com

Other information
Ka divergence:-0.00970528KaKs divergence:-0.317228
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1071Length 2 (bp):1089Length divergence:0.008
MFE 1 (kcal):-332.44MFE 2 (kcal):-328.95MFE divergence-0.005