Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03680-AT5G17980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):C2 calcium/lipid-binding plant phosphoribosyltransferase family protein
Function (paralog2):C2 calcium/lipid-binding plant phosphoribosyltransferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2007514426818
Log2 mRNA fold difference:-0.83153418072655
Log2 TE fold difference:-0.36805857823566
Sequences
Protein sequence

MADNVLRKLIVEICSARNLMPKDGQGTASAYAIVDFDGQRRRTKTKFRDLNPQWDEKLEF
FVHDVATMGEEILEINLCNDKKTGKRSTFLGKVKIAGSAFASAGSETLVYYPLEKRSVFS
QIKGEIGLKAYYVDENPPAAPAATEPKPEAAAATEEKPPEIAKAEDGKKETEAAKTEEKK
EGDKKEEEKPKEEAKPDEKKPDAPPDTKAKKPDTAVAPPPPPAEVKNPPIPQKAETVKQN
ELGIKPENVNRQDLIGSDLELPSLTRDQNRGGGYDLVDRMPFLYIRVAKAKRAKNDGSNP
VYAKLVIGTNGVKTRSQTGKDWDQVFAFEKESLNSTSLEVSVWSEEKIEKEDKTTTTTES
CLGTVSFDLQEVPKRVPPDSPLAPQWYTLESEKSPGNDVMLAVWLGTQADEAFQEAWQSD
SGGLIPETRSKVYLSPKLWYLRLTVIQTQDLQLGLGSEAKSKIPTTELYVKAQLGPQVFK
TARTSIGPSASSSGSGNPTWNEDLVFVASEPFEPFLIVTVEDITNGQSIGQTKIHMGSVE
RRNDDRTEPKSRWFNLAGDEKKPYSGRIHVKVCLEGGYHVLDEAAHVTSDVRPSAKQLAK
PPIGLLEVGIRGATNLLPVKTRDGTRGTTDAYVVAKYGPKWIRTRTILDRFNPRWNEQYT
WDVYDPCTVLTIGVFDNGRYKRDESGKQGRDVRVGKIRVRLSTLDMNRIYLNSYTLTVIL
PSGAKKMGEVEIAVRFSCPSWLSIIQAYVTPMLPRMHYVRPLGPAQQDILRHTAMRIVTA
RLARSEPPLGQEVVQYMLDTDNHVWSMRRSKANWFRVITFLSRAATIARWIHGIRTWVHP
PTTVLVHLLLVAIVLCPHLVLPTVFMYAFLILALRFRYRGRVKVNSVDPRLSCVDSVAPD
ELDEEFDGFPTTRQPEVVRIRYDRLRALAGRAQTLLGDVAAQGERVEALFNWRDPRATCI
FVVFCLFASFLFYIVPFKVFLLGSGFYYIRHPRFRDDMPSVPVNFFRRLPSMSDQIL

MATTRKLVVEVVDAKDLTPKDGHGTSSPYVVLDYYGQRRRTRTIVRDLNPVWNETLEFSL
AKRPSHQLFTDVLELDMYHDKNFGQTRRNNFLGRIRLGSDQFVGQGEEALIYYPLEKKSL
FNLVQGEIGLRVYYADEKPPPLKPTVAPLETVVEEKTEETKAEGPDESKPPPETNDIPAE
VKETVKPPQPPPEESSPAEGPKPDEEASPPLQENATVGGEEPPASESDKNEAEAKPVEEP
PQNQPDGEDIVLESEDTMSWASAPRSPLPEVIISRSVSGSIPETKNGPQPLRRSVSETAS
YTSEISDVSTIERSTFDLVEKMHYVFIRVVKARSLPTSGSPVTKISLSGTMIQSKPARKT
SCFEWDQTFAFLRDSPDLSSSPILEISVWDSSTGIETSQFLGGICFDVSEIPLRDPPDSP
LAPQWYRLEGGGAHNSDLMLATWTGTQADESFPDAWKTDTAGNVTARAKVYMSSKLWYLR
ATVIEAQDLLPPQLTAFKEASFQLKAQLGSQVQKTKSAVTRNGAPSWNEDLLFVAAEPFS
DQLVFTLEYRTSKGPVTVGMARVPLSAIERRVDDRLVASRWLGLEDPNDEKRGNRSRVHI
RLCFDGGYHVMDEAAHVCSDYRPTARQLWKPAVGIVELGIIGCKNLLPMKTVNGKGSTDA
YTVAKYGSKWVRTRTVSDSLDPKWNEQYTWKVYDPCTVLTIGVFDSWGVYEVDGGKEATR
QDLRIGKVRIRISTLETGKAYRNTYPLLMLVNGGVKKLGEIELAVRFVRTAPPLDFLHVY
TQPLLPLMHHIKPLSLFQEDMLRNTAVKILAAHLSRSEPPLRPEIVRYMLDADTHTFSMR
KVRANWLRIVNVVAGMVDVVRWVDDTRFWKNPTSTLLVHALVVMLIWFPDLIVPTLAFYL
FVIGAWNYRFRSRAALPHFDPRLSLADAADRDELDEEFDVVPSNRPPEMVRLRYDKLRNV
GARVQTILGEVAAQGEKMQALVTWRDPRATGIFVGLCFFVALVLYLVPTKMVAMASGFYY
FRHPIFRDRKPSPVLNFFRRLPSLSDRLM

www.000webhost.com

Other information
Ka divergence:-0.0235536KaKs divergence:0.108434
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):3054Length 2 (bp):3150Length divergence:0.015
MFE 1 (kcal):-1015.1MFE 2 (kcal):-1076.66MFE divergence0.029