Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03820-AT5G18080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.16315116190149
Log2 mRNA fold difference:-0.75196460223249
Log2 TE fold difference:0.38773013207151
Sequences
Protein sequence

MALVRGFMAAKKILGGSVAGTRKETSAPKGFLAVYVGESQRKKQRHLVPVSYLNQPLFQA
LLIKAEEEFGFNHPMGGLTIPCPEDTFLTVTSQIQG

MAFVRSLLGAKKILSRSTGAGSAAPKGFLAVYVGESQKKRYLVPVSYLNQPSFQALLSKS
EEEFGFDHPMGGLTIPCPEDTFINVTSRLQ

www.000webhost.com

Other information
Ka divergence:-0.617042KaKs divergence:0.0887545
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):291Length 2 (bp):273Length divergence:-0.032
MFE 1 (kcal):-91.8MFE 2 (kcal):-91.56MFE divergence-0.001