Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03860-AT5G18120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):APR-like 5
Function (paralog2):APR-like 7

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2836268774873
Log2 mRNA fold difference:-0.47018349481456
Log2 TE fold difference:-0.83627781974551
Sequences
Protein sequence

MDSRVSILFVCAIAVSCFTSGSASSPVDFSVCNYEFELFRFDLEAKCPPSLYPTPPIEVD
GDSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSMFPQIQHLAVEHSQALPSV
FSRYGIHSLPSILMVNQTLNARYHGRKDLISLIEFYEEATGLQPVQYVAEGEPTGLNAGD
GNLITWLRKGTSIREIFKQDPFLVLSLLFICLQMAILVFPIAESRMRALWASYVANLNLG
RFGEISQLFNRGIHMVDVRRLWLKLSLVKTRNFHERAKNAQAWASSLASVSLGQTSSDQS

MNLWVSIFLVSAIAGSCLPSGFAYVDVCNHEFEVFRSVIEQKCPRSLYPSPPIEVDGDLL
DKLMDANHGNAYISILFYTSRCPFSRAVRPKFDVLSSMFPHITHLIVEQSQALPSVFSRY
GIHSLPSILMVNQTMKMRYHGPKDLASLIQFYKETTGLKPVQYMDEGEPTSLDTDGNLIT
WLHNGSSIREIAEREPYMVLALMFLSLKLAILIFPIMGSRLKTLWALYVPHLSLGILGET
SQLFGRALHMIDVRRLWIKLRLTKTRNFQERAKNALASVSLGKSSSQSA

www.000webhost.com

Other information
Ka divergence:-0.198806KaKs divergence:0.649011
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):903Length 2 (bp):870Length divergence:-0.019
MFE 1 (kcal):-258.87MFE 2 (kcal):-248.49MFE divergence-0.02