Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G03870-AT5G18130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.72380775281974
Log2 mRNA fold difference:-0.57886967933087
Log2 TE fold difference:-0.040215131194394
Sequences
Protein sequence

MDLEDWELVLPKNSFKDLDLDHDEDHHGAMVMDYFLCPSTKDPLPKTESPPRSKVVPKKI
LQVPIAWEAVLDQDNTKIPNNPDLEPDPHPDPDSKPTLSTDSVSSPRVSFKIMKDTEFAD
MKIDPPARITSPLPQIDDAASKPSDLEGGDDLRDKKEVVLEEEDEDGSGGERLNLWKAGL
NGIGAICSFGVAAAAATVCVFFLGHNNIKICKNKNQMLRFQIYSDDNKRMKEVVNHATKL
NEAIFGMKGVPVVRAQISFGGHYDGL

MDLEDWEILPKINYKGLELDLGHEEDHEVTKMMRNTAKSFDSDYFICPIQDSVGKTEFLH
QRSSVVPTQLLQIPITWEPLSPVDDKDHNKYLDPDFSEPDPELLTESFPSPRITFKKSKE
TEFADMKIDSPAARFTSPLPQNDERHSDSEGGLGGESYDEIMGSEVEESSDLSSKKEVDW
DEGERTNLWKKGLNGIGAICSFGVAAAAATICVFFLGHNSSIQGGRNKNQILRFQIYSDD
NKRMNEVVKHATKLNEAISVMKGLPVARAQISFGGYYDAL

Other information
Ka divergence:0.235047KaKs divergence:0.438832
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):801Length 2 (bp):843Length divergence:0.026
MFE 1 (kcal):-267.3MFE 2 (kcal):-253.7MFE divergence-0.026